BLASTX nr result
ID: Cephaelis21_contig00027799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027799 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306450.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 >ref|XP_002306450.1| predicted protein [Populus trichocarpa] gi|222855899|gb|EEE93446.1| predicted protein [Populus trichocarpa] Length = 622 Score = 60.5 bits (145), Expect = 1e-07 Identities = 31/71 (43%), Positives = 43/71 (60%) Frame = +2 Query: 5 SDLILWLHTIDKYFHDLLLQPLKRVNESNQEDCLEGSPFWEDDFGAERQRISSHHLQRLV 184 S LILWL + +YF +LL +P+ ++ E+ Q++CLEGSPF E + S HLQR Sbjct: 329 STLILWLQLLHEYFEELLQKPISKL-EAGQDECLEGSPFLLGLSNGELDGMHSFHLQRQT 387 Query: 185 VFLLLRCSLIL 217 + L LRC L Sbjct: 388 LLLFLRCCFSL 398