BLASTX nr result
ID: Cephaelis21_contig00027773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027773 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534324.1| PREDICTED: uncharacterized protein LOC100817... 60 2e-07 >ref|XP_003534324.1| PREDICTED: uncharacterized protein LOC100817102 [Glycine max] Length = 249 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -3 Query: 106 YGQNNGFNSEFLSSASKLWAERGRLWQDVPYESLE 2 +G NNGF+SEF++SASK WAE+ LWQDV YESLE Sbjct: 25 FGNNNGFDSEFMASASKFWAEKASLWQDVQYESLE 59