BLASTX nr result
ID: Cephaelis21_contig00027680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027680 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533281.1| pentatricopeptide repeat-containing protein,... 122 3e-26 ref|XP_003611888.1| Pentatricopeptide repeat-containing protein ... 119 2e-25 ref|XP_003538834.1| PREDICTED: pentatricopeptide repeat-containi... 116 2e-24 ref|XP_002269506.1| PREDICTED: pentatricopeptide repeat-containi... 113 1e-23 ref|XP_002327713.1| predicted protein [Populus trichocarpa] gi|2... 111 7e-23 >ref|XP_002533281.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526906|gb|EEF29113.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 652 Score = 122 bits (306), Expect = 3e-26 Identities = 52/75 (69%), Positives = 61/75 (81%) Frame = -3 Query: 225 QVQLKPWLDPAALASALQHWRPEEVSTLEDAKVIWTTRLVCKMIRSFKSAEISWQFFCWV 46 +V+LKPWLDP ALA+AL W PE VS LEDAK +WTTRLVCK++R+F S E +W FFCWV Sbjct: 339 EVRLKPWLDPKALANALSQWSPEVVSMLEDAKFVWTTRLVCKVLRNFSSPETAWYFFCWV 398 Query: 45 ASQPGFTHDIYTTSR 1 A QPGFTHD+YT R Sbjct: 399 AYQPGFTHDVYTVQR 413 >ref|XP_003611888.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355513223|gb|AES94846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 659 Score = 119 bits (299), Expect = 2e-25 Identities = 49/74 (66%), Positives = 62/74 (83%) Frame = -3 Query: 222 VQLKPWLDPAALASALQHWRPEEVSTLEDAKVIWTTRLVCKMIRSFKSAEISWQFFCWVA 43 ++LKPWLDP +LASALQ+W P+EVS LE A +WTTRLVCK++RSF+S + +W FFCWVA Sbjct: 347 IRLKPWLDPRSLASALQNWSPDEVSALEGANFVWTTRLVCKILRSFRSPDTAWNFFCWVA 406 Query: 42 SQPGFTHDIYTTSR 1 +PGFTH+IYT R Sbjct: 407 DRPGFTHNIYTVQR 420 >ref|XP_003538834.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like [Glycine max] Length = 658 Score = 116 bits (290), Expect = 2e-24 Identities = 47/74 (63%), Positives = 59/74 (79%) Frame = -3 Query: 222 VQLKPWLDPAALASALQHWRPEEVSTLEDAKVIWTTRLVCKMIRSFKSAEISWQFFCWVA 43 + LKPW+DP AL SAL++W P+EV+ LE A +WTTRLVCKM+R+FK+ E +W FFCW A Sbjct: 350 IHLKPWMDPRALVSALRNWSPDEVAALESANFVWTTRLVCKMLRNFKTPEAAWSFFCWAA 409 Query: 42 SQPGFTHDIYTTSR 1 +Q GFTHDIYT R Sbjct: 410 NQRGFTHDIYTVQR 423 >ref|XP_002269506.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66631-like [Vitis vinifera] Length = 660 Score = 113 bits (283), Expect = 1e-23 Identities = 51/75 (68%), Positives = 60/75 (80%), Gaps = 1/75 (1%) Frame = -3 Query: 222 VQLKPWLDPAALASALQHWRPEEVSTLEDAKVIWTTRLVCKMIRSFKSAEISWQFFCWVA 43 VQLKPWLDP ALA+AL +W P EV LE+AK IWTTRLVCK++R+F S E +W+FFCWVA Sbjct: 336 VQLKPWLDPRALANALNNWDPNEVLALEEAKFIWTTRLVCKILRNFNSPETAWKFFCWVA 395 Query: 42 SQP-GFTHDIYTTSR 1 QP GF H+IYT R Sbjct: 396 YQPGGFNHNIYTVQR 410 >ref|XP_002327713.1| predicted protein [Populus trichocarpa] gi|222836798|gb|EEE75191.1| predicted protein [Populus trichocarpa] Length = 517 Score = 111 bits (277), Expect = 7e-23 Identities = 48/75 (64%), Positives = 57/75 (76%) Frame = -3 Query: 225 QVQLKPWLDPAALASALQHWRPEEVSTLEDAKVIWTTRLVCKMIRSFKSAEISWQFFCWV 46 +V+LKPWLDP ALA AL W P+ VS LEDAK +WTTRLV K++R+ S E +W FFCWV Sbjct: 203 EVRLKPWLDPRALAKALNKWSPDVVSALEDAKFVWTTRLVWKVLRNINSPETAWDFFCWV 262 Query: 45 ASQPGFTHDIYTTSR 1 A QPGFTH +YT R Sbjct: 263 AYQPGFTHCVYTVQR 277