BLASTX nr result
ID: Cephaelis21_contig00027608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027608 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002870473.1| predicted protein [Arabidopsis lyrata subsp.... 85 7e-15 emb|CAB16768.1| cytochrome like protein [Arabidopsis thaliana] 83 3e-14 ref|NP_195452.1| cytochrome P450, family 81, subfamily D, polype... 83 3e-14 ref|NP_568533.2| cytochrome P450 81D1 [Arabidopsis thaliana] gi|... 80 1e-13 dbj|BAA28538.1| cytochrome P450 monooxygenase [Arabidopsis thali... 80 1e-13 >ref|XP_002870473.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297316309|gb|EFH46732.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 502 Score = 84.7 bits (208), Expect = 7e-15 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 327 VGLALGSLIQCFEWQRVGPEEIDLTEGVGLTMPKAVPLEAKFKARDFVHKIL 172 VGLALGSLIQCFEW+RVG EE+D+ EGVG T+PKA+PL+A KAR F+HKIL Sbjct: 450 VGLALGSLIQCFEWERVGNEEVDMKEGVGNTVPKAIPLQAVCKARPFLHKIL 501 >emb|CAB16768.1| cytochrome like protein [Arabidopsis thaliana] Length = 185 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 327 VGLALGSLIQCFEWQRVGPEEIDLTEGVGLTMPKAVPLEAKFKARDFVHKIL 172 V L+LGSLIQCFEW+R+G EE+D+TEG GLTMPKA PLEA +ARDFV KIL Sbjct: 130 VTLSLGSLIQCFEWERIGEEEVDMTEGPGLTMPKARPLEAMCRARDFVGKIL 181 >ref|NP_195452.1| cytochrome P450, family 81, subfamily D, polypeptide 2 [Arabidopsis thaliana] gi|4468802|emb|CAB38203.1| cytochrome p450-like protein [Arabidopsis thaliana] gi|7270718|emb|CAB80401.1| cytochrome p450-like protein [Arabidopsis thaliana] gi|332661384|gb|AEE86784.1| cytochrome P450, family 81, subfamily D, polypeptide 2 [Arabidopsis thaliana] Length = 499 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -1 Query: 327 VGLALGSLIQCFEWQRVGPEEIDLTEGVGLTMPKAVPLEAKFKARDFVHKIL 172 V L+LGSLIQCFEW+R+G EE+D+TEG GLTMPKA PLEA +ARDFV KIL Sbjct: 444 VTLSLGSLIQCFEWERIGEEEVDMTEGPGLTMPKARPLEAMCRARDFVGKIL 495 >ref|NP_568533.2| cytochrome P450 81D1 [Arabidopsis thaliana] gi|13878373|sp|Q9FG65.1|C81D1_ARATH RecName: Full=Cytochrome P450 81D1 gi|9759034|dbj|BAB09361.1| cytochrome P450 [Arabidopsis thaliana] gi|20147351|gb|AAM10388.1| AT5g36220/T30G6_3 [Arabidopsis thaliana] gi|24111351|gb|AAN46799.1| At5g36220/T30G6_3 [Arabidopsis thaliana] gi|332006675|gb|AED94058.1| cytochrome P450 81D1 [Arabidopsis thaliana] Length = 502 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -1 Query: 327 VGLALGSLIQCFEWQRVGPEEIDLTEGVGLTMPKAVPLEAKFKARDFVHKIL 172 VGLALGSLIQCFEW+RVG E+D+ EGVG T+PKA+PL+A KAR F+HKI+ Sbjct: 450 VGLALGSLIQCFEWERVGNVEVDMKEGVGNTVPKAIPLKAICKARPFLHKII 501 >dbj|BAA28538.1| cytochrome P450 monooxygenase [Arabidopsis thaliana] Length = 500 Score = 80.5 bits (197), Expect = 1e-13 Identities = 37/52 (71%), Positives = 45/52 (86%) Frame = -1 Query: 327 VGLALGSLIQCFEWQRVGPEEIDLTEGVGLTMPKAVPLEAKFKARDFVHKIL 172 VGLALGSLIQCFEW+RVG E+D+ EGVG T+PKA+PL+A KAR F+HKI+ Sbjct: 448 VGLALGSLIQCFEWERVGNVEVDMKEGVGNTVPKAIPLKAICKARPFLHKII 499