BLASTX nr result
ID: Cephaelis21_contig00027544
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00027544 (384 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285679.1| PREDICTED: probable DNA primase large subuni... 58 7e-07 >ref|XP_002285679.1| PREDICTED: probable DNA primase large subunit [Vitis vinifera] gi|297741936|emb|CBI33371.3| unnamed protein product [Vitis vinifera] Length = 452 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = +2 Query: 269 SEENLRATLGKMGVGNRALEDVMERV*NKHYQV 367 SEENLRA LGKMGVGNRA+EDVM++V N+HYQ+ Sbjct: 380 SEENLRAALGKMGVGNRAMEDVMDKVRNRHYQL 412