BLASTX nr result
ID: Cephaelis21_contig00026755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00026755 (559 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 1e-05 >emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 744 Score = 54.7 bits (130), Expect = 1e-05 Identities = 22/64 (34%), Positives = 41/64 (64%) Frame = +1 Query: 328 VPIWVELEKLPIFLFNKEALYAVASTIGKLLRLDAATTAISKPSVARFQVELDLLKERPE 507 + +W+ +LP+ ++KEAL+A+A +GK +++D AT +++ AR +ELDL K Sbjct: 209 IMVWIRFPELPLEYYDKEALFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAKALVS 268 Query: 508 MIWI 519 +W+ Sbjct: 269 KVWV 272