BLASTX nr result
ID: Cephaelis21_contig00026730
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00026730 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich re... 48 8e-07 emb|CBI25352.3| unnamed protein product [Vitis vinifera] 48 8e-07 >ref|XP_002275275.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Vitis vinifera] Length = 969 Score = 48.1 bits (113), Expect(2) = 8e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 178 GSLSNPRSNWVSELVLDGFSLSGKLSRGLLQV 273 G NPRSN V++LVLDGFSLSGK+ RGLLQ+ Sbjct: 62 GVKCNPRSNRVTDLVLDGFSLSGKIGRGLLQL 93 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 150 NEDNDSPCNWV 182 NED+DSPCNWV Sbjct: 51 NEDDDSPCNWV 61 >emb|CBI25352.3| unnamed protein product [Vitis vinifera] Length = 847 Score = 48.1 bits (113), Expect(2) = 8e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +1 Query: 178 GSLSNPRSNWVSELVLDGFSLSGKLSRGLLQV 273 G NPRSN V++LVLDGFSLSGK+ RGLLQ+ Sbjct: 62 GVKCNPRSNRVTDLVLDGFSLSGKIGRGLLQL 93 Score = 29.6 bits (65), Expect(2) = 8e-07 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = +3 Query: 150 NEDNDSPCNWV 182 NED+DSPCNWV Sbjct: 51 NEDDDSPCNWV 61