BLASTX nr result
ID: Cephaelis21_contig00026572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00026572 (533 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003627350.1| Nuclear pore complex protein Nup107 [Medicag... 56 3e-06 ref|XP_002529197.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 ref|XP_002331185.1| predicted protein [Populus trichocarpa] gi|2... 56 4e-06 >ref|XP_003627350.1| Nuclear pore complex protein Nup107 [Medicago truncatula] gi|355521372|gb|AET01826.1| Nuclear pore complex protein Nup107 [Medicago truncatula] Length = 599 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -3 Query: 117 HIDLLALQVRGSHVGTYLPKSGIWHNTQ*FLMKGSSTLN 1 ++ +LA++VRGSHVG+YLP SG+WH+TQ +L KG+S N Sbjct: 290 YLHVLAMRVRGSHVGSYLPSSGVWHHTQRYLNKGTSDRN 328 >ref|XP_002529197.1| conserved hypothetical protein [Ricinus communis] gi|223531375|gb|EEF33211.1| conserved hypothetical protein [Ricinus communis] Length = 1088 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 105 LALQVRGSHVGTYLPKSGIWHNTQ*FLMKGSSTLN 1 L +VRGSHVGTYLP SGIWH+TQ FL KG+S+ N Sbjct: 265 LESKVRGSHVGTYLPNSGIWHHTQRFLRKGASSTN 299 >ref|XP_002331185.1| predicted protein [Populus trichocarpa] gi|222873306|gb|EEF10437.1| predicted protein [Populus trichocarpa] Length = 1096 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = -3 Query: 105 LALQVRGSHVGTYLPKSGIWHNTQ*FLMKGSSTLN 1 L +V+GSHVGTYLPKSGIWH TQ FL KG+S N Sbjct: 273 LESKVQGSHVGTYLPKSGIWHQTQRFLQKGASNTN 307