BLASTX nr result
ID: Cephaelis21_contig00026345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00026345 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC69002.1| hypothetical protein OsI_37783 [Oryza sativa Indi... 79 5e-13 ref|XP_002528044.1| conserved hypothetical protein [Ricinus comm... 77 1e-12 ref|XP_002327295.1| predicted protein [Populus trichocarpa] gi|2... 77 1e-12 gb|EEE52924.1| hypothetical protein OsJ_35544 [Oryza sativa Japo... 77 1e-12 gb|AFW56615.1| hypothetical protein ZEAMMB73_760336 [Zea mays] 77 1e-12 >gb|EEC69002.1| hypothetical protein OsI_37783 [Oryza sativa Indica Group] Length = 347 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 161 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK 268 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK Sbjct: 167 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK 202 >ref|XP_002528044.1| conserved hypothetical protein [Ricinus communis] gi|223532574|gb|EEF34362.1| conserved hypothetical protein [Ricinus communis] Length = 336 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +2 Query: 161 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK 268 GLHWTNDLPGAMIQC+LALKPDGLFLAAILGGETLK Sbjct: 157 GLHWTNDLPGAMIQCKLALKPDGLFLAAILGGETLK 192 >ref|XP_002327295.1| predicted protein [Populus trichocarpa] gi|222835665|gb|EEE74100.1| predicted protein [Populus trichocarpa] Length = 225 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +2 Query: 161 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK 268 GLHWTNDLPGAMIQC+LALKPDGLFLAAILGGETLK Sbjct: 46 GLHWTNDLPGAMIQCKLALKPDGLFLAAILGGETLK 81 >gb|EEE52924.1| hypothetical protein OsJ_35544 [Oryza sativa Japonica Group] Length = 348 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +2 Query: 161 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK 268 GLHWTNDLPGAMIQCRL+LKPDGLFLAAILGGETLK Sbjct: 168 GLHWTNDLPGAMIQCRLSLKPDGLFLAAILGGETLK 203 >gb|AFW56615.1| hypothetical protein ZEAMMB73_760336 [Zea mays] Length = 185 Score = 77.0 bits (188), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +2 Query: 161 GLHWTNDLPGAMIQCRLALKPDGLFLAAILGGETLK 268 GLHWTNDLPGAMIQCRLAL+PDGLFLAAILGGETLK Sbjct: 5 GLHWTNDLPGAMIQCRLALQPDGLFLAAILGGETLK 40