BLASTX nr result
ID: Cephaelis21_contig00026164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00026164 (486 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis ... 67 1e-09 ref|XP_002528529.1| auxin:hydrogen symporter, putative [Ricinus ... 67 1e-09 ref|XP_003612434.1| Auxin efflux carrier protein [Medicago trunc... 66 3e-09 ref|XP_003612431.1| Auxin efflux carrier protein [Medicago trunc... 66 3e-09 ref|XP_003612430.1| hypothetical protein MTR_5g024960 [Medicago ... 66 3e-09 >ref|NP_683316.2| auxin efflux carrier-like protein [Arabidopsis thaliana] gi|332191921|gb|AEE30042.1| auxin efflux carrier-like protein [Arabidopsis thaliana] Length = 472 Score = 67.4 bits (163), Expect = 1e-09 Identities = 27/41 (65%), Positives = 38/41 (92%) Frame = -2 Query: 485 GTMTQLFGIGENDCSSILFWNYAVASLALTLWLTYYMWLVS 363 GT+TQLFG GE++CS ILFW+YA+AS++LT+W T++MWLV+ Sbjct: 432 GTITQLFGSGESECSVILFWSYALASVSLTVWPTFFMWLVA 472 >ref|XP_002528529.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223532031|gb|EEF33841.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 447 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -2 Query: 485 GTMTQLFGIGENDCSSILFWNYAVASLALTLWLTYYMWLV 366 G MTQLFG GE++CS IL W+YAVAS++LTLW T++MWLV Sbjct: 407 GMMTQLFGAGESECSVILLWSYAVASVSLTLWSTFFMWLV 446 >ref|XP_003612434.1| Auxin efflux carrier protein [Medicago truncatula] gi|355513769|gb|AES95392.1| Auxin efflux carrier protein [Medicago truncatula] Length = 353 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 485 GTMTQLFGIGENDCSSILFWNYAVASLALTLWLTYYMWLVS 363 GT+ QLFG GE++CS ++ W YA+AS+A+TLW TY+MWLVS Sbjct: 313 GTIAQLFGAGESECSVMMLWTYALASIAVTLWSTYFMWLVS 353 >ref|XP_003612431.1| Auxin efflux carrier protein [Medicago truncatula] gi|355513766|gb|AES95389.1| Auxin efflux carrier protein [Medicago truncatula] Length = 417 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 485 GTMTQLFGIGENDCSSILFWNYAVASLALTLWLTYYMWLVS 363 GT+ QLFG GE++CS ++ W YA+AS+A+TLW TY+MWLVS Sbjct: 377 GTIAQLFGAGESECSVMMLWTYALASIAVTLWSTYFMWLVS 417 >ref|XP_003612430.1| hypothetical protein MTR_5g024960 [Medicago truncatula] gi|355513765|gb|AES95388.1| hypothetical protein MTR_5g024960 [Medicago truncatula] Length = 154 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -2 Query: 485 GTMTQLFGIGENDCSSILFWNYAVASLALTLWLTYYMWLVS 363 GT+ QLFG GE++CS ++ W YA+AS+A+TLW TY+MWLVS Sbjct: 114 GTIAQLFGAGESECSVMMLWTYALASIAVTLWSTYFMWLVS 154