BLASTX nr result
ID: Cephaelis21_contig00025461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025461 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529167.1| Coiled-coil domain-containing protein, putat... 55 8e-06 ref|XP_002285380.2| PREDICTED: HAUS augmin-like complex subunit ... 55 8e-06 >ref|XP_002529167.1| Coiled-coil domain-containing protein, putative [Ricinus communis] gi|223531391|gb|EEF33226.1| Coiled-coil domain-containing protein, putative [Ricinus communis] Length = 304 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 93 WLESEFSAVGKDVPEFEYTTRSIAHLHNIAT 1 WL S+F A GKDVPEFEYT RSI+HL+N+AT Sbjct: 36 WLTSQFEAAGKDVPEFEYTQRSISHLYNLAT 66 >ref|XP_002285380.2| PREDICTED: HAUS augmin-like complex subunit 1-like [Vitis vinifera] gi|147795301|emb|CAN69456.1| hypothetical protein VITISV_036572 [Vitis vinifera] gi|296083695|emb|CBI23684.3| unnamed protein product [Vitis vinifera] Length = 298 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 93 WLESEFSAVGKDVPEFEYTTRSIAHLHNIAT 1 WL S+F A GKDVP+FEYT R+IAHLHN++T Sbjct: 30 WLASQFDAAGKDVPDFEYTPRTIAHLHNLST 60