BLASTX nr result
ID: Cephaelis21_contig00025349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025349 (564 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284146.1| PREDICTED: probable mitochondrial saccharopi... 57 3e-06 >ref|XP_002284146.1| PREDICTED: probable mitochondrial saccharopine dehydrogenase At5g39410-like [Vitis vinifera] Length = 451 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -3 Query: 562 VMAACDYLDICGEPEFIEKMNIAYNEKAVEKDYLVI 455 V + CDYLDICGEPEF+E+M +AY+EKA EK LV+ Sbjct: 114 VESGCDYLDICGEPEFMERMEVAYHEKASEKGSLVV 149