BLASTX nr result
ID: Cephaelis21_contig00025314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025314 (455 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166846.1| PREDICTED: putative uridine kinase C227.14-l... 56 3e-06 ref|XP_004143866.1| PREDICTED: putative uridine kinase C227.14-l... 56 3e-06 >ref|XP_004166846.1| PREDICTED: putative uridine kinase C227.14-like [Cucumis sativus] Length = 251 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 455 TLREQGSDYAPSFDHGVGDPVEDDIFVDVR 366 TLR QGS YAPSFDHGVGDPVEDDIFV ++ Sbjct: 193 TLRSQGSVYAPSFDHGVGDPVEDDIFVGLQ 222 >ref|XP_004143866.1| PREDICTED: putative uridine kinase C227.14-like [Cucumis sativus] Length = 309 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 455 TLREQGSDYAPSFDHGVGDPVEDDIFVDVR 366 TLR QGS YAPSFDHGVGDPVEDDIFV ++ Sbjct: 193 TLRSQGSVYAPSFDHGVGDPVEDDIFVGLQ 222