BLASTX nr result
ID: Cephaelis21_contig00025223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025223 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC33015.1| hypothetical protein [Antirrhinum hispanicum] 62 4e-08 emb|CAN69016.1| hypothetical protein VITISV_016361 [Vitis vinifera] 60 2e-07 gb|AEV42258.1| hypothetical protein [Beta vulgaris] 59 4e-07 emb|CAN77801.1| hypothetical protein VITISV_031477 [Vitis vinifera] 59 4e-07 emb|CAC44142.1| putative polyprotein [Cicer arietinum] 59 5e-07 >emb|CAC33015.1| hypothetical protein [Antirrhinum hispanicum] Length = 1299 Score = 62.4 bits (150), Expect = 4e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -1 Query: 100 ILYTLRKWRHYLYGVTFEVFTDHKSLKYLFSQK 2 I++ L KWRHYLYG TFEV+TDHKSLKY+F+QK Sbjct: 858 IVFALAKWRHYLYGTTFEVYTDHKSLKYIFTQK 890 >emb|CAN69016.1| hypothetical protein VITISV_016361 [Vitis vinifera] Length = 1043 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -1 Query: 112 ECVQILYTLRKWRHYLYGVTFEVFTDHKSLKYLFSQK 2 E I++ L+ WRHYLYG FEVF+DHKSLKY+FSQK Sbjct: 551 ELAXIVFALKLWRHYLYGENFEVFSDHKSLKYIFSQK 587 >gb|AEV42258.1| hypothetical protein [Beta vulgaris] Length = 1553 Score = 58.9 bits (141), Expect = 4e-07 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = -1 Query: 112 ECVQILYTLRKWRHYLYGVTFEVFTDHKSLKYLFSQK 2 E I++ L+ WRHYLYGVT +FTDHKSLKY+F+QK Sbjct: 930 ELAAIVFALKIWRHYLYGVTCRIFTDHKSLKYIFTQK 966 >emb|CAN77801.1| hypothetical protein VITISV_031477 [Vitis vinifera] Length = 855 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -1 Query: 112 ECVQILYTLRKWRHYLYGVTFEVFTDHKSLKYLFSQK 2 E +++ L+ WRH+L+G T+E+FTDHKSLKYLFSQK Sbjct: 333 ELAAVVFALKIWRHFLFGETYEIFTDHKSLKYLFSQK 369 >emb|CAC44142.1| putative polyprotein [Cicer arietinum] Length = 655 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = -1 Query: 112 ECVQILYTLRKWRHYLYGVTFEVFTDHKSLKYLFSQK 2 E +++ L+ WRHYLYG TF VF+DHKSLKYLF QK Sbjct: 158 ELAAVVFALKIWRHYLYGCTFTVFSDHKSLKYLFDQK 194