BLASTX nr result
ID: Cephaelis21_contig00025159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025159 (602 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234239.1| cyclopropyl isomerase [Solanum lycopersicum]... 96 4e-18 ref|NP_001190504.1| cycloeucalenol cycloisomerase [Arabidopsis t... 92 5e-17 ref|XP_002864059.1| hypothetical protein ARALYDRAFT_495101 [Arab... 92 5e-17 dbj|BAD93898.1| cyclopropyl isomerase [Arabidopsis thaliana] 92 5e-17 ref|NP_568727.1| cycloeucalenol cycloisomerase [Arabidopsis thal... 92 5e-17 >ref|NP_001234239.1| cyclopropyl isomerase [Solanum lycopersicum] gi|209976078|gb|ACJ04083.1| cyclopropyl isomerase [Solanum lycopersicum] Length = 286 Score = 96.3 bits (238), Expect = 4e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = +1 Query: 469 MWLAQNPSKRWGELFFLLYTPFWLTLCLGIVVPYKLYETFTEWE 600 +WLAQNPSKRWGE+FFLLYTPFWLTLCLGIVVP+KLYE FTEWE Sbjct: 13 LWLAQNPSKRWGEVFFLLYTPFWLTLCLGIVVPFKLYEDFTEWE 56 >ref|NP_001190504.1| cycloeucalenol cycloisomerase [Arabidopsis thaliana] gi|332008553|gb|AED95936.1| cycloeucalenol cycloisomerase [Arabidopsis thaliana] Length = 284 Score = 92.4 bits (228), Expect = 5e-17 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 469 MWLAQNPSKRWGELFFLLYTPFWLTLCLGIVVPYKLYETFTEWE 600 +WLA NPSKRWGELFFL YTPFWLTLCLGIVVPYKLYETFTE E Sbjct: 9 LWLAPNPSKRWGELFFLFYTPFWLTLCLGIVVPYKLYETFTELE 52 >ref|XP_002864059.1| hypothetical protein ARALYDRAFT_495101 [Arabidopsis lyrata subsp. lyrata] gi|297309894|gb|EFH40318.1| hypothetical protein ARALYDRAFT_495101 [Arabidopsis lyrata subsp. lyrata] Length = 281 Score = 92.4 bits (228), Expect = 5e-17 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 469 MWLAQNPSKRWGELFFLLYTPFWLTLCLGIVVPYKLYETFTEWE 600 +WLA NPSKRWGELFFL YTPFWLTLCLGIVVPYKLYETFTE E Sbjct: 9 LWLAPNPSKRWGELFFLFYTPFWLTLCLGIVVPYKLYETFTELE 52 >dbj|BAD93898.1| cyclopropyl isomerase [Arabidopsis thaliana] Length = 280 Score = 92.4 bits (228), Expect = 5e-17 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 469 MWLAQNPSKRWGELFFLLYTPFWLTLCLGIVVPYKLYETFTEWE 600 +WLA NPSKRWGELFFL YTPFWLTLCLGIVVPYKLYETFTE E Sbjct: 9 LWLAPNPSKRWGELFFLFYTPFWLTLCLGIVVPYKLYETFTELE 52 >ref|NP_568727.1| cycloeucalenol cycloisomerase [Arabidopsis thaliana] gi|24211551|sp|Q9M643.1|CCI1_ARATH RecName: Full=Cycloeucalenol cycloisomerase; AltName: Full=Cycloeucalenol--obtusifoliol isomerase; AltName: Full=Cyclopropyl sterol isomerase gi|7715089|gb|AAF67863.1|AF216756_1 cyclopropyl isomerase [Arabidopsis thaliana] gi|107738422|gb|ABF83694.1| At5g50375 [Arabidopsis thaliana] gi|332008552|gb|AED95935.1| cycloeucalenol cycloisomerase [Arabidopsis thaliana] Length = 280 Score = 92.4 bits (228), Expect = 5e-17 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +1 Query: 469 MWLAQNPSKRWGELFFLLYTPFWLTLCLGIVVPYKLYETFTEWE 600 +WLA NPSKRWGELFFL YTPFWLTLCLGIVVPYKLYETFTE E Sbjct: 9 LWLAPNPSKRWGELFFLFYTPFWLTLCLGIVVPYKLYETFTELE 52