BLASTX nr result
ID: Cephaelis21_contig00025113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025113 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 89 5e-16 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 75 5e-12 ref|XP_002535310.1| conserved hypothetical protein [Ricinus comm... 61 1e-07 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/47 (87%), Positives = 41/47 (87%) Frame = -2 Query: 179 HKGVVARVSPPGILHLAFMISTFNCAPEAGSKHARPVCFFHDML*SW 39 H GVVARVS PGILHLAFMISTF CAPE SKHARPVCFFHDML SW Sbjct: 753 HMGVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWSW 799 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 75.1 bits (183), Expect = 5e-12 Identities = 37/41 (90%), Positives = 37/41 (90%) Frame = -2 Query: 125 MISTFNCAPEAGSKHARPVCFFHDML*SWVSSSGLLALEEV 3 MISTFNCAPE SKHARPVCFFHDML S VSSSGLLALEEV Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWSRVSSSGLLALEEV 41 >ref|XP_002535310.1| conserved hypothetical protein [Ricinus communis] gi|255590896|ref|XP_002535392.1| conserved hypothetical protein [Ricinus communis] gi|223523262|gb|EEF26991.1| conserved hypothetical protein [Ricinus communis] gi|223523475|gb|EEF27071.1| conserved hypothetical protein [Ricinus communis] Length = 94 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +2 Query: 2 RLLLRLEDHWKTPRTRACRERSTLGGRASTLPPGHS 109 RLLL LEDH P TRACRERSTLGGRAST+ PGHS Sbjct: 59 RLLLTLEDHRNIPGTRACRERSTLGGRASTVSPGHS 94