BLASTX nr result
ID: Cephaelis21_contig00025039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00025039 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABU51784.1| putative NBS domain resistance protein [Coffea sp... 91 1e-16 gb|ABU51767.1| putative NBS domain resistance protein [Coffea sp... 88 6e-16 gb|ABU51776.1| putative NBS domain resistance protein [Coffea sp... 81 8e-14 gb|ABU51736.1| putative NBS domain resistance protein [Coffea sp... 81 8e-14 gb|ABU51770.1| putative NBS domain resistance protein [Coffea sp... 81 1e-13 >gb|ABU51784.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 151 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/67 (65%), Positives = 56/67 (83%), Gaps = 2/67 (2%) Frame = +3 Query: 6 FLQRA-RYAIVFDDVWHIDFWDEFRFVLPENSYGGNLVMLTTRIADVA-YSCVDLNGYVF 179 FLQ+A RYAIVFDDVW ++FW+ +F LPE+S+GGN VMLTTRIADVA SC++ G+V+ Sbjct: 49 FLQQAGRYAIVFDDVWDVEFWNTIKFALPESSHGGNRVMLTTRIADVASASCIESRGFVY 108 Query: 180 RMEYLSL 200 RME LS+ Sbjct: 109 RMEPLSI 115 >gb|ABU51767.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 150 Score = 88.2 bits (217), Expect = 6e-16 Identities = 43/67 (64%), Positives = 55/67 (82%), Gaps = 2/67 (2%) Frame = +3 Query: 6 FLQRA-RYAIVFDDVWHIDFWDEFRFVLPENSYGGNLVMLTTRIADVAY-SCVDLNGYVF 179 FLQ+A RYAIVFDDVW ++FW+ +F LPE+S+GGN VMLTTR ADVA+ SC++ G V+ Sbjct: 48 FLQQAGRYAIVFDDVWDVEFWNTIKFALPESSHGGNRVMLTTRKADVAFASCIESRGLVY 107 Query: 180 RMEYLSL 200 RME LS+ Sbjct: 108 RMEPLSI 114 >gb|ABU51776.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 150 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/68 (61%), Positives = 53/68 (77%), Gaps = 2/68 (2%) Frame = +3 Query: 3 GFLQRA-RYAIVFDDVWHIDFWDEFRFVLPENSYGGNLVMLTTRIADVA-YSCVDLNGYV 176 GFLQ+A RYAIVFDDVW+++FW+E +F LPE +Y GN VMLTTR ADVA SC + YV Sbjct: 48 GFLQKAARYAIVFDDVWNVEFWNEIKFALPEGNY-GNRVMLTTRKADVASASCTESQDYV 106 Query: 177 FRMEYLSL 200 ++ E LS+ Sbjct: 107 YKKEPLSI 114 >gb|ABU51736.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 144 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/67 (62%), Positives = 54/67 (80%), Gaps = 2/67 (2%) Frame = +3 Query: 6 FLQRA-RYAIVFDDVWHIDFWDEFRFVLPENSYGGNLVMLTTRIADVA-YSCVDLNGYVF 179 FLQ+A RYAIVFDDVW ++FW+E +F LPE++Y GN VMLTTR ADVA SC++ YV+ Sbjct: 44 FLQQAGRYAIVFDDVWDVEFWNEIKFALPESNY-GNHVMLTTRKADVASASCIESQDYVY 102 Query: 180 RMEYLSL 200 +ME LS+ Sbjct: 103 KMEPLSI 109 >gb|ABU51770.1| putative NBS domain resistance protein [Coffea spp. mixed genomic library] Length = 151 Score = 80.9 bits (198), Expect = 1e-13 Identities = 42/67 (62%), Positives = 52/67 (77%), Gaps = 2/67 (2%) Frame = +3 Query: 6 FLQRA-RYAIVFDDVWHIDFWDEFRFVLPENSYGGNLVMLTTRIADVA-YSCVDLNGYVF 179 FLQRA RYAIVFDDVW ++FW+E +F LPE +Y GN VMLTTR ADVA SC + YV+ Sbjct: 49 FLQRAGRYAIVFDDVWDVEFWNEIKFALPEGNY-GNRVMLTTRNADVASASCTESQAYVY 107 Query: 180 RMEYLSL 200 +ME L++ Sbjct: 108 KMEPLAI 114