BLASTX nr result
ID: Cephaelis21_contig00023835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023835 (646 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535013.1| maintenance of killer 16 (mak16) protein, pu... 59 8e-07 >ref|XP_002535013.1| maintenance of killer 16 (mak16) protein, putative [Ricinus communis] gi|223524194|gb|EEF27371.1| maintenance of killer 16 (mak16) protein, putative [Ricinus communis] Length = 304 Score = 58.9 bits (141), Expect = 8e-07 Identities = 29/57 (50%), Positives = 37/57 (64%) Frame = -2 Query: 510 DDDEYTAAYGHKSKGKDSGMSQRKLEKDEPGAKSKKKAKVLVEVEHDDGSERRTTVY 340 DD E GH + ++ RK KDEPGAK KKKA+V+VEVEH+D SER+ V+ Sbjct: 248 DDAETNGKVGHIRVRSEFDLASRKHGKDEPGAKLKKKARVIVEVEHEDASERQKAVH 304