BLASTX nr result
ID: Cephaelis21_contig00023833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023833 (498 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312032.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002312032.1| predicted protein [Populus trichocarpa] gi|222851852|gb|EEE89399.1| predicted protein [Populus trichocarpa] Length = 624 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = +2 Query: 2 SVELFLQLEKSGKDAPFTQYYRSILEKAAVRTLHNKGKKRMPKLKMSKLKRGQFTESSL 178 SVE FLQLEK G +APFT+YY S++EKA R L GK + K SK KR Q ++++ Sbjct: 553 SVESFLQLEKCGGNAPFTKYYTSVIEKAGSRNLLMNGKISSLEQKKSKGKRQQTPKNAI 611