BLASTX nr result
ID: Cephaelis21_contig00023037
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00023037 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517451.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_002517451.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543462|gb|EEF44993.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 428 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = -3 Query: 148 TQRSIRAWKWCMSMAQRCTTMYELKTIHGIFIAHGLHRNNYA 23 T+ SI+AWK CMS+ Q+C M +LK IH FI +G+H N YA Sbjct: 8 TKLSIKAWKHCMSLVQQCANMRQLKAIHATFIVNGIHTNTYA 49