BLASTX nr result
ID: Cephaelis21_contig00022407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022407 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524359.1| RNA binding protein, putative [Ricinus commu... 68 7e-10 ref|XP_002326676.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 >ref|XP_002524359.1| RNA binding protein, putative [Ricinus communis] gi|223536320|gb|EEF37970.1| RNA binding protein, putative [Ricinus communis] Length = 1744 Score = 68.2 bits (165), Expect = 7e-10 Identities = 37/78 (47%), Positives = 47/78 (60%) Frame = +1 Query: 1 NPNYRFQGIEWII*YNLEL*FCDILTA*PLVGILVCERILDAVTSVMTAVDMPLEMLLLF 180 NP YRF+ + II P V VCE++L A TSV++ VD+PLE+LL F Sbjct: 572 NPKYRFRVLNTII-------------VIPFVIFAVCEKVLGAATSVVSTVDVPLEVLLHF 618 Query: 181 ISCLPRDLTDLGGPLRFK 234 +S LPR+ TD GGPLR K Sbjct: 619 VSTLPREFTDYGGPLRVK 636 >ref|XP_002326676.1| predicted protein [Populus trichocarpa] gi|222833998|gb|EEE72475.1| predicted protein [Populus trichocarpa] Length = 1224 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +1 Query: 85 PLVGILVCERILDAVTSVMTAVDMPLEMLLLFISCLPRDLTDLGGPLRFK 234 P + VCE++L+A TS+++ +D+PLE+LL FI+ LPR TD GG LR K Sbjct: 65 PYYRLQVCEKVLEAATSLVSTLDVPLEILLHFIATLPRAFTDYGGSLRLK 114