BLASTX nr result
ID: Cephaelis21_contig00022392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022392 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase ac... 128 5e-28 ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase ac... 121 7e-26 gb|ABK24069.1| unknown [Picea sitchensis] 121 7e-26 ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase ac... 118 4e-25 ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase ac... 117 1e-24 >ref|XP_002274016.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1 [Vitis vinifera] gi|297743001|emb|CBI35868.3| unnamed protein product [Vitis vinifera] Length = 391 Score = 128 bits (321), Expect = 5e-28 Identities = 56/66 (84%), Positives = 63/66 (95%) Frame = -3 Query: 337 ADEESGDVPDGELCVICLMRRRRSAFIPCGHLVCCQRCAFSVERDLSPKCPVCRQTIRSS 158 A++++GDVPDGELCVICLMRR+RSAF+PCGHLVCCQRCA SVER+LSPKCPVCRQ IRSS Sbjct: 326 AEDDAGDVPDGELCVICLMRRKRSAFVPCGHLVCCQRCALSVERELSPKCPVCRQIIRSS 385 Query: 157 VRIYDS 140 VRIY S Sbjct: 386 VRIYGS 391 >ref|XP_004141700.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] gi|449480528|ref|XP_004155921.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Cucumis sativus] Length = 389 Score = 121 bits (303), Expect = 7e-26 Identities = 54/65 (83%), Positives = 59/65 (90%) Frame = -3 Query: 334 DEESGDVPDGELCVICLMRRRRSAFIPCGHLVCCQRCAFSVERDLSPKCPVCRQTIRSSV 155 DE S VPDG+LCVICLMRR+RSAFIPCGHLVCC+RCA SVER+ SPKCP+CRQ IRSSV Sbjct: 325 DELSSHVPDGQLCVICLMRRKRSAFIPCGHLVCCERCAVSVERESSPKCPICRQQIRSSV 384 Query: 154 RIYDS 140 RIYDS Sbjct: 385 RIYDS 389 >gb|ABK24069.1| unknown [Picea sitchensis] Length = 394 Score = 121 bits (303), Expect = 7e-26 Identities = 53/66 (80%), Positives = 60/66 (90%) Frame = -3 Query: 337 ADEESGDVPDGELCVICLMRRRRSAFIPCGHLVCCQRCAFSVERDLSPKCPVCRQTIRSS 158 A++ESG+VPDGELCV+CLMRRRRSAFIPCGH VCC RCA VERD +PKCPVCRQ +R+S Sbjct: 329 AEDESGNVPDGELCVVCLMRRRRSAFIPCGHHVCCSRCAQLVERDSNPKCPVCRQNVRNS 388 Query: 157 VRIYDS 140 VRIYDS Sbjct: 389 VRIYDS 394 >ref|XP_003520919.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] Length = 388 Score = 118 bits (296), Expect = 4e-25 Identities = 52/65 (80%), Positives = 58/65 (89%) Frame = -3 Query: 334 DEESGDVPDGELCVICLMRRRRSAFIPCGHLVCCQRCAFSVERDLSPKCPVCRQTIRSSV 155 D+E DVPDG+LCVICLMRRRRS FIPCGHLVCCQ CA SVER+++PKCPVCRQ IR SV Sbjct: 324 DDEIEDVPDGQLCVICLMRRRRSVFIPCGHLVCCQGCAISVEREVAPKCPVCRQEIRDSV 383 Query: 154 RIYDS 140 RIY+S Sbjct: 384 RIYES 388 >ref|XP_003552078.1| PREDICTED: mitochondrial ubiquitin ligase activator of nfkb 1-like [Glycine max] Length = 387 Score = 117 bits (292), Expect = 1e-24 Identities = 51/65 (78%), Positives = 57/65 (87%) Frame = -3 Query: 334 DEESGDVPDGELCVICLMRRRRSAFIPCGHLVCCQRCAFSVERDLSPKCPVCRQTIRSSV 155 D+E D PDG+LCVICLMRRRRS FIPCGHLVCCQ CA SVER+++PKCPVCRQ IR SV Sbjct: 323 DDEIEDAPDGQLCVICLMRRRRSVFIPCGHLVCCQGCAISVEREVAPKCPVCRQEIRDSV 382 Query: 154 RIYDS 140 RIY+S Sbjct: 383 RIYES 387