BLASTX nr result
ID: Cephaelis21_contig00022124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00022124 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524929.1| chromatin binding protein, putative [Ricinus... 81 1e-13 ref|XP_004141897.1| PREDICTED: mortality factor 4-like protein 1... 77 2e-12 ref|XP_002283618.1| PREDICTED: mortality factor 4-like protein 1... 73 3e-11 gb|AFK35210.1| unknown [Medicago truncatula] 69 3e-10 ref|XP_003524665.1| PREDICTED: nuA4 complex subunit EAF3 homolog... 69 3e-10 >ref|XP_002524929.1| chromatin binding protein, putative [Ricinus communis] gi|223535764|gb|EEF37426.1| chromatin binding protein, putative [Ricinus communis] Length = 318 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 142 DDSASDGENSSGDGPESDSALFSEGEKVLAYHGPKIYEAKVQKAEVR 2 DDS SDGE SSGD P S+S +FSEGE+VLAYHGP+IYEAKVQKAE+R Sbjct: 7 DDSGSDGETSSGDAPPSNSGIFSEGERVLAYHGPRIYEAKVQKAELR 53 >ref|XP_004141897.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus] gi|449523073|ref|XP_004168549.1| PREDICTED: mortality factor 4-like protein 1-like [Cucumis sativus] Length = 316 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/47 (72%), Positives = 43/47 (91%) Frame = -2 Query: 142 DDSASDGENSSGDGPESDSALFSEGEKVLAYHGPKIYEAKVQKAEVR 2 DD+A+DG+ SSGD P S+++L+SEGEKVLAYHGP+IYEAKVQK E+R Sbjct: 7 DDAATDGDMSSGDSPPSNTSLYSEGEKVLAYHGPRIYEAKVQKVELR 53 >ref|XP_002283618.1| PREDICTED: mortality factor 4-like protein 1 [Vitis vinifera] gi|296087392|emb|CBI33766.3| unnamed protein product [Vitis vinifera] Length = 321 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/47 (72%), Positives = 39/47 (82%) Frame = -2 Query: 142 DDSASDGENSSGDGPESDSALFSEGEKVLAYHGPKIYEAKVQKAEVR 2 DDS +D + S+GD P S+S FSEGEKVLAYHGP+IYEAKVQKAE R Sbjct: 10 DDSTTDADTSTGDLPASNSGTFSEGEKVLAYHGPRIYEAKVQKAEFR 56 >gb|AFK35210.1| unknown [Medicago truncatula] Length = 161 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = -2 Query: 139 DSASDGENSSGDGPESDSALFSEGEKVLAYHGPKIYEAKVQKAEV 5 DSA+ G+ SGD P SDS ++S GEKVLAYHGP+IYEAKVQKAE+ Sbjct: 9 DSANFGDGPSGDVPSSDSRVYSAGEKVLAYHGPRIYEAKVQKAEI 53 >ref|XP_003524665.1| PREDICTED: nuA4 complex subunit EAF3 homolog [Glycine max] Length = 319 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/47 (68%), Positives = 41/47 (87%) Frame = -2 Query: 142 DDSASDGENSSGDGPESDSALFSEGEKVLAYHGPKIYEAKVQKAEVR 2 +DSA+ + S+GD S+SA++SEGEKVLAYHGP+IYEAKVQKAE+R Sbjct: 8 NDSATSADASAGDVQPSNSAVYSEGEKVLAYHGPRIYEAKVQKAEIR 54