BLASTX nr result
ID: Cephaelis21_contig00021903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021903 (894 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517986.1| PREDICTED: uncharacterized protein LOC100819... 46 1e-05 ref|XP_003555075.1| PREDICTED: uncharacterized protein LOC100805... 46 1e-05 >ref|XP_003517986.1| PREDICTED: uncharacterized protein LOC100819936 [Glycine max] Length = 1267 Score = 46.2 bits (108), Expect(2) = 1e-05 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -3 Query: 580 PSHLKYVYLGDEKTLPVIIARGLTAEQKERLIQVLK 473 PS+LKY YL D K+ PVII+ L EQ+E+L+ VLK Sbjct: 203 PSNLKYAYLDDSKSFPVIISASLADEQEEKLLSVLK 238 Score = 29.6 bits (65), Expect(2) = 1e-05 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 476 EKHRTAIEWTLADIKGIN 423 +KH+ AI WTLADI GI+ Sbjct: 238 KKHKKAIGWTLADIPGIS 255 >ref|XP_003555075.1| PREDICTED: uncharacterized protein LOC100805765 [Glycine max] Length = 976 Score = 46.2 bits (108), Expect(2) = 1e-05 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = -3 Query: 580 PSHLKYVYLGDEKTLPVIIARGLTAEQKERLIQVLK 473 PS+LKY YL D K+ PVII+ L EQ+E+L+ VLK Sbjct: 203 PSNLKYAYLDDSKSFPVIISASLAYEQEEKLLSVLK 238 Score = 29.6 bits (65), Expect(2) = 1e-05 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -2 Query: 476 EKHRTAIEWTLADIKGIN 423 +KH+ AI WTLADI GI+ Sbjct: 238 KKHKKAIGWTLADIPGIS 255