BLASTX nr result
ID: Cephaelis21_contig00021798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021798 (556 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528516.1| Ubiquinone biosynthesis protein coq-8, putat... 62 8e-08 gb|ABA94171.1| ABC1 family protein [Oryza sativa Japonica Group] 60 3e-07 ref|XP_003577474.1| PREDICTED: uncharacterized aarF domain-conta... 60 3e-07 ref|NP_001176591.1| Os11g0549635 [Oryza sativa Japonica Group] g... 60 3e-07 gb|EAZ18695.1| hypothetical protein OsJ_34215 [Oryza sativa Japo... 60 3e-07 >ref|XP_002528516.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] gi|223532076|gb|EEF33885.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Length = 548 Score = 61.6 bits (148), Expect = 8e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 105 VHLRSAKRILRLCE*NRGFYVKARQFVVALRQVPK 1 VHLRSAKRIL+LCE N+GFYVKA QFV A+RQVPK Sbjct: 99 VHLRSAKRILKLCEANKGFYVKAGQFVAAMRQVPK 133 >gb|ABA94171.1| ABC1 family protein [Oryza sativa Japonica Group] Length = 495 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 105 VHLRSAKRILRLCE*NRGFYVKARQFVVALRQVPK 1 VHLRSAK+IL+LCE NRGFYVKA QFV ++RQVPK Sbjct: 80 VHLRSAKKILKLCEANRGFYVKAGQFVSSIRQVPK 114 >ref|XP_003577474.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Brachypodium distachyon] Length = 527 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 105 VHLRSAKRILRLCE*NRGFYVKARQFVVALRQVPK 1 VHLRSAK++L+LCE NRGFYVKA QFV +LRQVPK Sbjct: 79 VHLRSAKKLLKLCEANRGFYVKAGQFVSSLRQVPK 113 >ref|NP_001176591.1| Os11g0549635 [Oryza sativa Japonica Group] gi|255680170|dbj|BAH95319.1| Os11g0549635 [Oryza sativa Japonica Group] Length = 244 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 105 VHLRSAKRILRLCE*NRGFYVKARQFVVALRQVPK 1 VHLRSAK+IL+LCE NRGFYVKA QFV ++RQVPK Sbjct: 80 VHLRSAKKILKLCEANRGFYVKAGQFVSSIRQVPK 114 >gb|EAZ18695.1| hypothetical protein OsJ_34215 [Oryza sativa Japonica Group] Length = 495 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = -2 Query: 105 VHLRSAKRILRLCE*NRGFYVKARQFVVALRQVPK 1 VHLRSAK+IL+LCE NRGFYVKA QFV ++RQVPK Sbjct: 80 VHLRSAKKILKLCEANRGFYVKAGQFVSSIRQVPK 114