BLASTX nr result
ID: Cephaelis21_contig00021305
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021305 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147231.1| PREDICTED: 50S ribosomal protein L19, chloro... 75 7e-12 ref|XP_002870097.1| ribosomal protein L19 family protein [Arabid... 70 2e-10 ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloro... 69 3e-10 gb|ACF23041.1| ST10 [Eutrema halophilum] 69 3e-10 emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] 69 3e-10 >ref|XP_004147231.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] gi|449523724|ref|XP_004168873.1| PREDICTED: 50S ribosomal protein L19, chloroplastic-like [Cucumis sativus] Length = 221 Score = 74.7 bits (182), Expect = 7e-12 Identities = 54/150 (36%), Positives = 68/150 (45%), Gaps = 19/150 (12%) Frame = +3 Query: 18 MASIVLPQALCTILRNSGQSQTASQKLGAFSAAVSQKTXXXXXXXXXXXXXXXXFGKVNS 197 MAS +LPQA+ +I RN +Q A ++LG SA + Sbjct: 1 MASKILPQAVISIPRNP--NQCAPRRLGFCSAVSGTRVSFSTLSSSSIGSHFHHTVAAPL 58 Query: 198 HRSFVLRXXXXXXXXXXXXX-------------------KPRGMPRIKFGDVMGILNKRA 320 R+FV+R KP PR+K GDVMGILNKRA Sbjct: 59 RRAFVVRAEANPEADSAAEEAPEAEVEAAVESDAQPEEEKPSRKPRVKLGDVMGILNKRA 118 Query: 321 IEESEELRPRPDIRTGDVVEFKMEFSDKWR 410 IE SE+ RP PDIRTGD+VE K+E + R Sbjct: 119 IEASEKERPIPDIRTGDIVELKLEVQENRR 148 >ref|XP_002870097.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] gi|297315933|gb|EFH46356.1| ribosomal protein L19 family protein [Arabidopsis lyrata subsp. lyrata] Length = 225 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +3 Query: 258 KPRGMPRIKFGDVMGILNKRAIEESEELRPRPDIRTGDVVEFKMEFSDKWR 410 KP+ PRIK GDVMGILN+RAIE SE++RP P+IRTGD+VE K+E + R Sbjct: 102 KPQRKPRIKLGDVMGILNQRAIEVSEKVRPVPEIRTGDIVEIKLEVPENKR 152 >ref|XP_002264869.2| PREDICTED: 50S ribosomal protein L19, chloroplastic [Vitis vinifera] gi|296088907|emb|CBI38456.3| unnamed protein product [Vitis vinifera] Length = 231 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +3 Query: 258 KPRGMPRIKFGDVMGILNKRAIEESEELRPRPDIRTGDVVEFKMEFSDKWR 410 KP PR+K GD+MGILNKRAIE SE+ RP PD+RTGD+VE K+E + R Sbjct: 108 KPPRKPRVKLGDIMGILNKRAIEASEKERPVPDLRTGDIVEIKLEVPENRR 158 >gb|ACF23041.1| ST10 [Eutrema halophilum] Length = 136 Score = 69.3 bits (168), Expect = 3e-10 Identities = 33/51 (64%), Positives = 40/51 (78%) Frame = +3 Query: 258 KPRGMPRIKFGDVMGILNKRAIEESEELRPRPDIRTGDVVEFKMEFSDKWR 410 KP PRIK GDVMGILN+RAIE SE++RP P+IRTGD+VE K+E + R Sbjct: 13 KPARKPRIKLGDVMGILNQRAIEVSEKVRPVPEIRTGDIVEIKLEVPENRR 63 >emb|CAN82787.1| hypothetical protein VITISV_037813 [Vitis vinifera] Length = 231 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/51 (62%), Positives = 39/51 (76%) Frame = +3 Query: 258 KPRGMPRIKFGDVMGILNKRAIEESEELRPRPDIRTGDVVEFKMEFSDKWR 410 KP PR+K GD+MGILNKRAIE SE+ RP PD+RTGD+VE K+E + R Sbjct: 108 KPPRKPRVKLGDIMGILNKRAIEASEKERPVPDLRTGDIVEIKLEVPENRR 158