BLASTX nr result
ID: Cephaelis21_contig00021296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00021296 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 emb|CBI26569.3| unnamed protein product [Vitis vinifera] 55 8e-06 >ref|XP_002275213.2| PREDICTED: pentatricopeptide repeat-containing protein At5g42310, mitochondrial-like [Vitis vinifera] Length = 494 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 117 IYRKQHKKIVDIYREMESAGCTPDRKAREVLQAAEMAVQQR 239 I ++ K+ +IY EMESAGCTPDRKARE+LQ A + +QQR Sbjct: 419 IRARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQR 459 >emb|CBI26569.3| unnamed protein product [Vitis vinifera] Length = 392 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +3 Query: 117 IYRKQHKKIVDIYREMESAGCTPDRKAREVLQAAEMAVQQR 239 I ++ K+ +IY EMESAGCTPDRKARE+LQ A + +QQR Sbjct: 340 IRARKFDKVPEIYEEMESAGCTPDRKAREMLQTALLVLQQR 380