BLASTX nr result
ID: Cephaelis21_contig00020834
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020834 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528966.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-depen... 63 2e-08 ref|XP_003534148.1| PREDICTED: cyclin-dependent kinase D-1-like ... 62 6e-08 gb|AAK97227.1|AF302013_1 CDK-activating kinase [Medicago sativa ... 62 6e-08 ref|XP_003530942.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-depen... 61 8e-08 ref|XP_002532521.1| cak1, putative [Ricinus communis] gi|2235277... 61 1e-07 >ref|XP_003528966.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase D-1-like [Glycine max] Length = 411 Score = 63.2 bits (152), Expect = 2e-08 Identities = 32/35 (91%), Positives = 34/35 (97%), Gaps = 1/35 (2%) Frame = +1 Query: 163 MSEVD-SKKVADRYLKREVLGEGTYGVVYKAIDTK 264 M+E+D SKKVADRYLKREVLGEGTYGVVYKAIDTK Sbjct: 1 MAELDLSKKVADRYLKREVLGEGTYGVVYKAIDTK 35 >ref|XP_003534148.1| PREDICTED: cyclin-dependent kinase D-1-like [Glycine max] Length = 411 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/35 (88%), Positives = 34/35 (97%), Gaps = 1/35 (2%) Frame = +1 Query: 163 MSEVD-SKKVADRYLKREVLGEGTYGVVYKAIDTK 264 M+E+D SKKVADRYLKREVLGEGTYGVVYKAIDT+ Sbjct: 1 MAELDLSKKVADRYLKREVLGEGTYGVVYKAIDTQ 35 >gb|AAK97227.1|AF302013_1 CDK-activating kinase [Medicago sativa subsp. x varia] Length = 412 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/35 (88%), Positives = 34/35 (97%), Gaps = 1/35 (2%) Frame = +1 Query: 163 MSEVD-SKKVADRYLKREVLGEGTYGVVYKAIDTK 264 M+E+D SKKVADRYLKREVLGEGTYGVVYKAIDT+ Sbjct: 1 MTELDPSKKVADRYLKREVLGEGTYGVVYKAIDTQ 35 >ref|XP_003530942.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase D-1-like [Glycine max] Length = 413 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/34 (91%), Positives = 33/34 (97%), Gaps = 1/34 (2%) Frame = +1 Query: 163 MSEVD-SKKVADRYLKREVLGEGTYGVVYKAIDT 261 MS++D SKKVADRYLKREVLGEGTYGVVYKAIDT Sbjct: 1 MSDMDPSKKVADRYLKREVLGEGTYGVVYKAIDT 34 >ref|XP_002532521.1| cak1, putative [Ricinus communis] gi|223527752|gb|EEF29855.1| cak1, putative [Ricinus communis] Length = 399 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/35 (88%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +1 Query: 163 MSEVDS-KKVADRYLKREVLGEGTYGVVYKAIDTK 264 MSE D KKVADRYLKRE+LGEGTYGVVYKAIDTK Sbjct: 1 MSENDGEKKVADRYLKREILGEGTYGVVYKAIDTK 35