BLASTX nr result
ID: Cephaelis21_contig00020783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020783 (1367 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|2... 77 8e-12 ref|XP_002530980.1| conserved hypothetical protein [Ricinus comm... 70 2e-09 ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|2... 65 5e-08 >ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Length = 687 Score = 77.4 bits (189), Expect = 8e-12 Identities = 35/61 (57%), Positives = 47/61 (77%) Frame = -3 Query: 183 QEKTTYVWVERDASSTYVFPKEIKNLIEKDIVPGVLKMPLSVSSYKDCFHALLYAEDCYL 4 Q K +Y+WV++ S Y PK+I++LI++D VPGVL PLS+S+YKD F ALLYAED Y+ Sbjct: 228 QTKVSYMWVQKGMSPIYAIPKDIEDLIKRDKVPGVLNKPLSLSTYKDYFAALLYAEDFYI 287 Query: 3 E 1 E Sbjct: 288 E 288 >ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 69.7 bits (169), Expect = 2e-09 Identities = 33/61 (54%), Positives = 46/61 (75%) Frame = -3 Query: 183 QEKTTYVWVERDASSTYVFPKEIKNLIEKDIVPGVLKMPLSVSSYKDCFHALLYAEDCYL 4 Q+ Y+ V++D + Y+ PK+I++LI+ D VP VLK PLS+S+YKD F ALLYAED Y+ Sbjct: 259 QKIAHYILVQKDITPIYMIPKDIESLIKSDKVPEVLKKPLSLSTYKDYFAALLYAEDYYI 318 Query: 3 E 1 E Sbjct: 319 E 319 >ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Length = 773 Score = 64.7 bits (156), Expect = 5e-08 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -3 Query: 183 QEKTTYVWVERDASSTYVFPKEIKNLIEKDIVPGVLKMPLSVSSYKDCFHALLYAEDCYL 4 Q K +Y V++ S Y PK+I++LI++DIVP VL LS S+YKD F ALLYAED Y+ Sbjct: 310 QTKVSYSLVQKVMSPIYAVPKDIEDLIKRDIVPEVLNEMLSPSTYKDYFAALLYAEDFYI 369 Query: 3 E 1 E Sbjct: 370 E 370