BLASTX nr result
ID: Cephaelis21_contig00020233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00020233 (411 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI26078.3| unnamed protein product [Vitis vinifera] 67 1e-09 ref|NP_001237676.1| uncharacterized protein LOC100305597 [Glycin... 66 3e-09 ref|XP_004143307.1| PREDICTED: protein BUD31 homolog 2-like [Cuc... 66 3e-09 ref|XP_002533999.1| Protein G10, putative [Ricinus communis] gi|... 66 3e-09 ref|NP_001237406.1| uncharacterized protein LOC100527276 [Glycin... 65 4e-09 >emb|CBI26078.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 67.4 bits (163), Expect = 1e-09 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = +2 Query: 293 FFSV*IMPKVKTNRVQYPQGWELIEPTLSELQAKMREAE 409 F S IMPKVKTNRV+YP+GWELIEPTL ELQ KMREAE Sbjct: 27 FLSHRIMPKVKTNRVKYPEGWELIEPTLRELQGKMREAE 65 >ref|NP_001237676.1| uncharacterized protein LOC100305597 [Glycine max] gi|356512435|ref|XP_003524924.1| PREDICTED: protein BUD31 homolog 2-like [Glycine max] gi|255626029|gb|ACU13359.1| unknown [Glycine max] Length = 145 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 311 MPKVKTNRVQYPQGWELIEPTLSELQAKMREAE 409 MPKVKTNRV+YP+GWELIEPTL ELQAKMREAE Sbjct: 1 MPKVKTNRVKYPEGWELIEPTLRELQAKMREAE 33 >ref|XP_004143307.1| PREDICTED: protein BUD31 homolog 2-like [Cucumis sativus] gi|449511850|ref|XP_004164071.1| PREDICTED: protein BUD31 homolog 2-like [Cucumis sativus] Length = 145 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 311 MPKVKTNRVQYPQGWELIEPTLSELQAKMREAE 409 MPK+KTNRV+YP+GWELIEPTL ELQAKMREAE Sbjct: 1 MPKIKTNRVKYPEGWELIEPTLRELQAKMREAE 33 >ref|XP_002533999.1| Protein G10, putative [Ricinus communis] gi|223526001|gb|EEF28380.1| Protein G10, putative [Ricinus communis] Length = 145 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 311 MPKVKTNRVQYPQGWELIEPTLSELQAKMREAE 409 MPKVKTNRV YP+GWELIEPTL ELQAKMREAE Sbjct: 1 MPKVKTNRVNYPEGWELIEPTLRELQAKMREAE 33 >ref|NP_001237406.1| uncharacterized protein LOC100527276 [Glycine max] gi|255631932|gb|ACU16333.1| unknown [Glycine max] Length = 145 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 311 MPKVKTNRVQYPQGWELIEPTLSELQAKMREAE 409 MPKVKTNRV YP+GWELIEPTL ELQAKMREAE Sbjct: 1 MPKVKTNRVTYPEGWELIEPTLHELQAKMREAE 33