BLASTX nr result
ID: Cephaelis21_contig00019414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019414 (572 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518926.1| RNA-binding protein, putative [Ricinus commu... 77 3e-12 ref|XP_003571320.1| PREDICTED: polyadenylate-binding protein, cy... 76 3e-12 dbj|BAJ96189.1| predicted protein [Hordeum vulgare subsp. vulgare] 76 3e-12 ref|NP_001031131.1| CTC-interacting domain 11 protein [Arabidops... 75 6e-12 ref|NP_174556.1| CTC-interacting domain 11 protein [Arabidopsis ... 75 6e-12 >ref|XP_002518926.1| RNA-binding protein, putative [Ricinus communis] gi|223541913|gb|EEF43459.1| RNA-binding protein, putative [Ricinus communis] Length = 379 Score = 76.6 bits (187), Expect = 3e-12 Identities = 37/45 (82%), Positives = 40/45 (88%), Gaps = 3/45 (6%) Frame = -3 Query: 126 YCS---MQVTQADVKLFFESICGEVYRLRLLGDYQHSTRIAFVEF 1 YC+ +VTQADVKLFFES+CGEVYRLRLLGDY HSTRIAFVEF Sbjct: 294 YCTNIDKKVTQADVKLFFESVCGEVYRLRLLGDYHHSTRIAFVEF 338 Score = 68.9 bits (167), Expect = 5e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 551 EGTRNALSLTGTMLGYYPVRVLPSKTVIAPVNPTFLPR 438 EG R AL+L GT+LGYYPVRVLPSKT IAPVNPTFLPR Sbjct: 244 EGARAALNLAGTVLGYYPVRVLPSKTAIAPVNPTFLPR 281 >ref|XP_003571320.1| PREDICTED: polyadenylate-binding protein, cytoplasmic and nuclear-like [Brachypodium distachyon] Length = 328 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 3/45 (6%) Frame = -3 Query: 126 YCS---MQVTQADVKLFFESICGEVYRLRLLGDYQHSTRIAFVEF 1 YC+ +V+QADVKLFFESICGEVYRLRLLGDYQH+TRIAFVEF Sbjct: 243 YCTNIDRKVSQADVKLFFESICGEVYRLRLLGDYQHNTRIAFVEF 287 Score = 69.3 bits (168), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 551 EGTRNALSLTGTMLGYYPVRVLPSKTVIAPVNPTFLPR 438 EG R AL+L+GT+LGYYPVRVLPSKT IAPVNPTFLPR Sbjct: 193 EGARAALTLSGTVLGYYPVRVLPSKTAIAPVNPTFLPR 230 >dbj|BAJ96189.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 324 Score = 76.3 bits (186), Expect = 3e-12 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 3/45 (6%) Frame = -3 Query: 126 YCS---MQVTQADVKLFFESICGEVYRLRLLGDYQHSTRIAFVEF 1 YC+ +V+QADVKLFFESICGEVYRLRLLGDYQH+TRIAFVEF Sbjct: 239 YCTNIDKKVSQADVKLFFESICGEVYRLRLLGDYQHNTRIAFVEF 283 Score = 69.3 bits (168), Expect = 4e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 551 EGTRNALSLTGTMLGYYPVRVLPSKTVIAPVNPTFLPR 438 EG R AL+L+GT+LGYYPVRVLPSKT IAPVNPTFLPR Sbjct: 189 EGARAALTLSGTVLGYYPVRVLPSKTAIAPVNPTFLPR 226 >ref|NP_001031131.1| CTC-interacting domain 11 protein [Arabidopsis thaliana] gi|332193409|gb|AEE31530.1| CTC-interacting domain 11 protein [Arabidopsis thaliana] Length = 406 Score = 75.5 bits (184), Expect = 6e-12 Identities = 36/45 (80%), Positives = 40/45 (88%), Gaps = 3/45 (6%) Frame = -3 Query: 126 YCS---MQVTQADVKLFFESICGEVYRLRLLGDYQHSTRIAFVEF 1 YC+ +VTQ+DVK+FFES CGEVYRLRLLGDYQHSTRIAFVEF Sbjct: 273 YCTNIDKKVTQSDVKIFFESFCGEVYRLRLLGDYQHSTRIAFVEF 317 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 551 EGTRNALSLTGTMLGYYPVRVLPSKTVIAPVNPTFLPR 438 EG AL+L+GTMLG+YPV+VLPSKT IAPVNPTFLPR Sbjct: 223 EGAMTALNLSGTMLGFYPVKVLPSKTAIAPVNPTFLPR 260 >ref|NP_174556.1| CTC-interacting domain 11 protein [Arabidopsis thaliana] gi|6714278|gb|AAF25974.1|AC017118_11 F6N18.17 [Arabidopsis thaliana] gi|332193408|gb|AEE31529.1| CTC-interacting domain 11 protein [Arabidopsis thaliana] Length = 358 Score = 75.5 bits (184), Expect = 6e-12 Identities = 36/45 (80%), Positives = 40/45 (88%), Gaps = 3/45 (6%) Frame = -3 Query: 126 YCS---MQVTQADVKLFFESICGEVYRLRLLGDYQHSTRIAFVEF 1 YC+ +VTQ+DVK+FFES CGEVYRLRLLGDYQHSTRIAFVEF Sbjct: 273 YCTNIDKKVTQSDVKIFFESFCGEVYRLRLLGDYQHSTRIAFVEF 317 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 551 EGTRNALSLTGTMLGYYPVRVLPSKTVIAPVNPTFLPR 438 EG AL+L+GTMLG+YPV+VLPSKT IAPVNPTFLPR Sbjct: 223 EGAMTALNLSGTMLGFYPVKVLPSKTAIAPVNPTFLPR 260