BLASTX nr result
ID: Cephaelis21_contig00019351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019351 (635 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284108.1| PREDICTED: dof zinc finger protein DOF3.4 [V... 76 6e-12 gb|AAK76521.1| putative Dof zinc finger protein [Arabidopsis tha... 75 1e-11 gb|AAX54942.2| Dof1 [Triticum aestivum] 75 1e-11 ref|NP_188764.1| Dof zinc finger protein DOF3.1 [Arabidopsis tha... 75 1e-11 gb|AFW73213.1| hypothetical protein ZEAMMB73_639009 [Zea mays] 75 1e-11 >ref|XP_002284108.1| PREDICTED: dof zinc finger protein DOF3.4 [Vitis vinifera] Length = 226 Score = 75.9 bits (185), Expect = 6e-12 Identities = 30/32 (93%), Positives = 32/32 (100%) Frame = -1 Query: 635 YYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPV 540 YYNNYNLSQPRHFCKSCRRYWT+GGTLRN+PV Sbjct: 40 YYNNYNLSQPRHFCKSCRRYWTQGGTLRNIPV 71 >gb|AAK76521.1| putative Dof zinc finger protein [Arabidopsis thaliana] Length = 204 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 635 YYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPV 540 YYNNYNLSQPRHFCKSCRRYWT+GG LRNVPV Sbjct: 43 YYNNYNLSQPRHFCKSCRRYWTKGGALRNVPV 74 >gb|AAX54942.2| Dof1 [Triticum aestivum] Length = 291 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 635 YYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPV 540 YYNNYNLSQPRHFCKSCRRYWT+GG LRNVPV Sbjct: 62 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPV 93 >ref|NP_188764.1| Dof zinc finger protein DOF3.1 [Arabidopsis thaliana] gi|55584039|sp|Q94AR6.2|DOF31_ARATH RecName: Full=Dof zinc finger protein DOF3.1; Short=AtDOF3.1 gi|3608263|dbj|BAA33197.1| Dof zinc finger protein [Arabidopsis thaliana] gi|9280230|dbj|BAB01720.1| Dof zinc finger protein-like [Arabidopsis thaliana] gi|23297302|gb|AAN12936.1| Dof zinc finger protein [Arabidopsis thaliana] gi|332642965|gb|AEE76486.1| Dof zinc finger protein DOF3.1 [Arabidopsis thaliana] Length = 204 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 635 YYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPV 540 YYNNYNLSQPRHFCKSCRRYWT+GG LRNVPV Sbjct: 43 YYNNYNLSQPRHFCKSCRRYWTKGGALRNVPV 74 >gb|AFW73213.1| hypothetical protein ZEAMMB73_639009 [Zea mays] Length = 300 Score = 74.7 bits (182), Expect = 1e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 635 YYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPV 540 YYNNYNLSQPRHFCKSCRRYWT+GG LRNVPV Sbjct: 64 YYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPV 95