BLASTX nr result
ID: Cephaelis21_contig00019214
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019214 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322098.1| predicted protein [Populus trichocarpa] gi|2... 109 3e-22 ref|XP_004160441.1| PREDICTED: pentatricopeptide repeat-containi... 102 4e-20 ref|XP_002529554.1| pentatricopeptide repeat-containing protein,... 100 2e-19 ref|NP_188429.1| pentatricopeptide repeat-containing protein [Ar... 99 3e-19 ref|XP_004137553.1| PREDICTED: pentatricopeptide repeat-containi... 99 4e-19 >ref|XP_002322098.1| predicted protein [Populus trichocarpa] gi|222869094|gb|EEF06225.1| predicted protein [Populus trichocarpa] Length = 668 Score = 109 bits (272), Expect = 3e-22 Identities = 62/127 (48%), Positives = 79/127 (62%) Frame = -3 Query: 382 RLISPPKPPLNPITISAPLSFFSTFIHQDHHFHNSNLQSQDKINFESLTDHSYWTKRIHK 203 +L P KP L+P LSF ST N QS +T+ SYWT++IH Sbjct: 11 KLSIPFKPKLSP------LSFLSTHPQNQEQALNHQQQSI------CITNRSYWTQKIHD 58 Query: 202 LCTVDRNVDSALDLLNHICLHGYLLNALNISSIIHGLCDAGRFSEAHNQLLLFINSHQFN 23 LCT RNVD AL LL+H+ L GYL ++LN+SSIIHGLCDA RF+EAH +L++F+ S Sbjct: 59 LCTKHRNVDEALRLLDHLRLRGYLPDSLNLSSIIHGLCDANRFNEAHQRLIIFLTS--LC 116 Query: 22 ILDERTC 2 + DERTC Sbjct: 117 VPDERTC 123 >ref|XP_004160441.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Cucumis sativus] Length = 681 Score = 102 bits (253), Expect = 4e-20 Identities = 62/133 (46%), Positives = 82/133 (61%), Gaps = 1/133 (0%) Frame = -3 Query: 397 HR-MSLRLISPPKPPLNPITISAPLSFFSTFIHQDHHFHNSNLQSQDKINFESLTDHSYW 221 HR +S++++S IT S + F T Q H N + S++ ES+ D SYW Sbjct: 6 HRSLSIKIVS--------ITPSISILFTRTANFQRLHPENGS-DSREWAPEESVADVSYW 56 Query: 220 TKRIHKLCTVDRNVDSALDLLNHICLHGYLLNALNISSIIHGLCDAGRFSEAHNQLLLFI 41 TK+IH LCT DRNVD AL LL+ + LHGY + LN++S+IHGLCDA RF EAH + +L I Sbjct: 57 TKKIHGLCTKDRNVDEALQLLDALRLHGYQFHPLNLASVIHGLCDAHRFHEAHCRFMLSI 116 Query: 40 NSHQFNILDERTC 2 S + DERTC Sbjct: 117 ASR--CVPDERTC 127 >ref|XP_002529554.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223530966|gb|EEF32823.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 99.8 bits (247), Expect = 2e-19 Identities = 59/125 (47%), Positives = 76/125 (60%), Gaps = 5/125 (4%) Frame = -3 Query: 361 PPLNPITISAPLSFFSTFIHQDHHFHNSNLQSQDKINFE-----SLTDHSYWTKRIHKLC 197 PP+ S PL+F ST H+ +H + ++ E S+T+ SYWTK+IH LC Sbjct: 10 PPILLKPSSVPLTFLSTH-HRPYHEVLLPQEQYQQLQQEQEQPISITNSSYWTKKIHLLC 68 Query: 196 TVDRNVDSALDLLNHICLHGYLLNALNISSIIHGLCDAGRFSEAHNQLLLFINSHQFNIL 17 T R VD AL LL+H+ L GY ++LN SSIIH LCDA RF EAH++ LL I S + Sbjct: 69 TQQRKVDEALTLLDHLRLSGYRPDSLNFSSIIHALCDAKRFKEAHHRFLLCIASD--CVP 126 Query: 16 DERTC 2 DERTC Sbjct: 127 DERTC 131 >ref|NP_188429.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75274006|sp|Q9LSK8.1|PP240_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g18020 gi|11994208|dbj|BAB01330.1| unnamed protein product [Arabidopsis thaliana] gi|332642514|gb|AEE76035.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 688 Score = 99.4 bits (246), Expect = 3e-19 Identities = 52/117 (44%), Positives = 70/117 (59%) Frame = -3 Query: 352 NPITISAPLSFFSTFIHQDHHFHNSNLQSQDKINFESLTDHSYWTKRIHKLCTVDRNVDS 173 N S LSF S + + + + + S+TD +YW +RIH +C V RN D Sbjct: 14 NGFFFSKSLSFSSASVLKSDDVEGEDDAIEAEDRRRSVTDRAYWRRRIHSICAVRRNPDE 73 Query: 172 ALDLLNHICLHGYLLNALNISSIIHGLCDAGRFSEAHNQLLLFINSHQFNILDERTC 2 AL +L+ +CL GY ++LN+SS+IH LCDAGRF EAH + LLF+ S I DERTC Sbjct: 74 ALRILDGLCLRGYRPDSLNLSSVIHSLCDAGRFDEAHRRFLLFLASG--FIPDERTC 128 >ref|XP_004137553.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18020-like [Cucumis sativus] Length = 646 Score = 99.0 bits (245), Expect = 4e-19 Identities = 49/82 (59%), Positives = 60/82 (73%) Frame = -3 Query: 247 ESLTDHSYWTKRIHKLCTVDRNVDSALDLLNHICLHGYLLNALNISSIIHGLCDAGRFSE 68 ES+ D SYWTK+IH LCT DRNVD AL LL+ + LHGY + LN++S+IHGLCDA RF E Sbjct: 15 ESVADVSYWTKKIHGLCTKDRNVDEALQLLDALRLHGYQFHPLNLASVIHGLCDAHRFHE 74 Query: 67 AHNQLLLFINSHQFNILDERTC 2 AH + +L I S + DERTC Sbjct: 75 AHCRFMLSIASR--CVPDERTC 94