BLASTX nr result
ID: Cephaelis21_contig00019101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00019101 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268533.1| PREDICTED: uncharacterized protein LOC100267... 60 2e-07 emb|CBI28665.3| unnamed protein product [Vitis vinifera] 60 2e-07 >ref|XP_002268533.1| PREDICTED: uncharacterized protein LOC100267311 [Vitis vinifera] Length = 561 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 451 RWSCILYRLGQKQLSRLFLKEAEYALQLALSEGN 350 RWS I+YR GQKQL+RLFLKEAE+ALQL+LSEGN Sbjct: 528 RWSSIVYRRGQKQLTRLFLKEAEHALQLSLSEGN 561 >emb|CBI28665.3| unnamed protein product [Vitis vinifera] Length = 565 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 451 RWSCILYRLGQKQLSRLFLKEAEYALQLALSEGN 350 RWS I+YR GQKQL+RLFLKEAE+ALQL+LSEGN Sbjct: 532 RWSSIVYRRGQKQLTRLFLKEAEHALQLSLSEGN 565