BLASTX nr result
ID: Cephaelis21_contig00018499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018499 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|2... 81 8e-14 ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|2... 73 3e-11 ref|XP_002530980.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 ref|XP_002534631.1| hypothetical protein RCOM_0173910 [Ricinus c... 59 4e-07 >ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Length = 773 Score = 81.3 bits (199), Expect = 8e-14 Identities = 36/73 (49%), Positives = 51/73 (69%) Frame = +2 Query: 2 AEDCYLEKWDGFEMKNVKVQLHEAAIYTRRGKPGNLNIYDDKDEKVFVAFELDKIRERRP 181 AED Y+EKW F++KN+ ++L +AAI +RG+ +KD K FV FE+D RE+RP Sbjct: 364 AEDFYIEKWSKFKLKNIALKLKDAAIIKKRGRNEYFGESHEKDNKTFVEFEIDSCREKRP 423 Query: 182 FLISRDFVYLQPS 220 FL+SRDF + +PS Sbjct: 424 FLLSRDFAFARPS 436 >ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Length = 687 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/73 (45%), Positives = 49/73 (67%) Frame = +2 Query: 2 AEDCYLEKWDGFEMKNVKVQLHEAAIYTRRGKPGNLNIYDDKDEKVFVAFELDKIRERRP 181 AED Y+EKW F+++N+ ++L A I + + N +KD+K+FV FE+D ERRP Sbjct: 282 AEDFYIEKWSEFKLENITLKLQRAEIIKKSRRNEYRNETYEKDDKIFVEFEIDSCCERRP 341 Query: 182 FLISRDFVYLQPS 220 FL+SRDF + +PS Sbjct: 342 FLLSRDFAFARPS 354 >ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/77 (44%), Positives = 46/77 (59%), Gaps = 4/77 (5%) Frame = +2 Query: 2 AEDCYLEKWDGFEMKNVKVQLHEAAIYTRRGKPGNLNIYDDKDE----KVFVAFELDKIR 169 AED Y+EKW F++ + ++L E AI + IY KD K VAFE+D Sbjct: 313 AEDYYIEKWSKFKLVGITIKLQETAI--------SKQIYFGKDYETDVKHLVAFEIDSSH 364 Query: 170 ERRPFLISRDFVYLQPS 220 E+RPFL+SRDFV+ +PS Sbjct: 365 EKRPFLLSRDFVFARPS 381 >ref|XP_002534631.1| hypothetical protein RCOM_0173910 [Ricinus communis] gi|223524877|gb|EEF27754.1| hypothetical protein RCOM_0173910 [Ricinus communis] Length = 171 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/67 (43%), Positives = 44/67 (65%) Frame = +2 Query: 20 EKWDGFEMKNVKVQLHEAAIYTRRGKPGNLNIYDDKDEKVFVAFELDKIRERRPFLISRD 199 +KW F++ + ++L EAAI+ K + +KDEK+FVAF +D E+RPFL+SRD Sbjct: 7 QKWSEFKLLGITLKLQEAAIF----KGPYIRESYEKDEKIFVAFNMDSSLEKRPFLLSRD 62 Query: 200 FVYLQPS 220 FV+ + S Sbjct: 63 FVFAKSS 69