BLASTX nr result
ID: Cephaelis21_contig00018479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018479 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF17663.1| putative long-chain acyl-CoA synthetase [Capsicum... 80 2e-13 ref|NP_194116.1| long chain acyl-CoA synthetase 4 [Arabidopsis t... 80 2e-13 ref|XP_002509957.1| acyl CoA synthetase, putative [Ricinus commu... 79 3e-13 gb|ACB30545.1| long-chain acyl-CoA synthetase 4 [Ricinus communis] 79 3e-13 gb|ABC02880.1| ACS1 [Ricinus communis] 79 3e-13 >gb|ACF17663.1| putative long-chain acyl-CoA synthetase [Capsicum annuum] Length = 658 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/47 (76%), Positives = 42/47 (89%) Frame = -2 Query: 469 EECFINIRASIGFWRGDVKLLMEDIAKLKPTIFCAIHRVLDRIHSGI 329 EECFI+ ASIGFWRGDVKLL EDI +LKPT+FCA+ RVLDRI+SG+ Sbjct: 286 EECFIHHGASIGFWRGDVKLLTEDIGELKPTVFCAVPRVLDRIYSGL 332 >ref|NP_194116.1| long chain acyl-CoA synthetase 4 [Arabidopsis thaliana] gi|75213733|sp|Q9T0A0.1|LACS4_ARATH RecName: Full=Long chain acyl-CoA synthetase 4 gi|20805869|gb|AAM28871.1|AF503754_1 long chain acyl-CoA synthetase 4 [Arabidopsis thaliana] gi|4972089|emb|CAB43885.1| acyl-CoA synthetase-like protein [Arabidopsis thaliana] gi|7269234|emb|CAB81303.1| acyl-CoA synthetase-like protein [Arabidopsis thaliana] gi|15146196|gb|AAK83581.1| AT4g23850/T32A16_20 [Arabidopsis thaliana] gi|332659412|gb|AEE84812.1| long chain acyl-CoA synthetase 4 [Arabidopsis thaliana] Length = 666 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 469 EECFINIRASIGFWRGDVKLLMEDIAKLKPTIFCAIHRVLDRIHSGI 329 EECFI A+IGFWRGDVKLL+ED+A+LKPTIFCA+ RVLDR++SG+ Sbjct: 287 EECFIQHGAAIGFWRGDVKLLIEDLAELKPTIFCAVPRVLDRVYSGL 333 >ref|XP_002509957.1| acyl CoA synthetase, putative [Ricinus communis] gi|223549856|gb|EEF51344.1| acyl CoA synthetase, putative [Ricinus communis] Length = 565 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 469 EECFINIRASIGFWRGDVKLLMEDIAKLKPTIFCAIHRVLDRIHSGI 329 EE FI+ ASIGFWRGDVKLL+EDI +LKPTIFCA+ RVLDRIHSG+ Sbjct: 245 EELFISHGASIGFWRGDVKLLIEDIGELKPTIFCAVPRVLDRIHSGL 291 >gb|ACB30545.1| long-chain acyl-CoA synthetase 4 [Ricinus communis] Length = 665 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 469 EECFINIRASIGFWRGDVKLLMEDIAKLKPTIFCAIHRVLDRIHSGI 329 EE FI+ ASIGFWRGDVKLL+EDI +LKPTIFCA+ RVLDRIHSG+ Sbjct: 289 EELFISHGASIGFWRGDVKLLIEDIGELKPTIFCAVPRVLDRIHSGL 335 >gb|ABC02880.1| ACS1 [Ricinus communis] Length = 656 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/47 (78%), Positives = 42/47 (89%) Frame = -2 Query: 469 EECFINIRASIGFWRGDVKLLMEDIAKLKPTIFCAIHRVLDRIHSGI 329 EE FI+ ASIGFWRGDVKLL+EDI +LKPTIFCA+ RVLDRIHSG+ Sbjct: 280 EELFISHGASIGFWRGDVKLLIEDIGELKPTIFCAVPRVLDRIHSGL 326