BLASTX nr result
ID: Cephaelis21_contig00018442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018442 (1040 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519316.1| Squamosa promoter-binding protein, putative ... 47 7e-06 >ref|XP_002519316.1| Squamosa promoter-binding protein, putative [Ricinus communis] gi|223541631|gb|EEF43180.1| Squamosa promoter-binding protein, putative [Ricinus communis] Length = 1026 Score = 47.0 bits (110), Expect(2) = 7e-06 Identities = 28/71 (39%), Positives = 39/71 (54%) Frame = -2 Query: 547 AIIGHC*SFLGTLKILIHPAAGHIVLDTPLPHQNDKSYRIANIKQIVVCASCEVEFSDKG 368 A + HC SF+ G +VLDTPLP ++ K RI++IK I V S +F+ KG Sbjct: 555 ARVQHCVSFIYN---------GQVVLDTPLPLKSHKHCRISSIKPIAVTLSERTDFTVKG 605 Query: 367 VNLSLPTARSL 335 N+ P+ R L Sbjct: 606 FNIFRPSTRLL 616 Score = 29.6 bits (65), Expect(2) = 7e-06 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = -3 Query: 234 RLLCVIKGKYLAHERCVDVI-RVDLHVE*AETEKLSFTYSIPEV 106 RLLC ++GKYL E D++ D E + + L+F SIP + Sbjct: 614 RLLCALEGKYLVQETSRDLMDGADTTNEHNKLQCLTFPCSIPNI 657