BLASTX nr result
ID: Cephaelis21_contig00018415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018415 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613502.1| Tetratricopeptide repeat protein [Medicago t... 58 7e-07 ref|XP_002520165.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 ref|XP_003519185.1| PREDICTED: tetratricopeptide repeat protein ... 55 8e-06 ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein ... 55 8e-06 >ref|XP_003613502.1| Tetratricopeptide repeat protein [Medicago truncatula] gi|355514837|gb|AES96460.1| Tetratricopeptide repeat protein [Medicago truncatula] Length = 468 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +1 Query: 1 EKQLKKRGGVQFLWRLLEKSYRMLERPEAAHAGERAHALKVAYF 132 EKQ+KKR G FLWRLLE+ Y++ RPEAA A E+A + AYF Sbjct: 424 EKQIKKRDGTAFLWRLLERGYKLANRPEAAIANEKAKVFESAYF 467 >ref|XP_002520165.1| conserved hypothetical protein [Ricinus communis] gi|223540657|gb|EEF42220.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 1 EKQLKKRGGVQFLWRLLEKSYRMLERPEAAHAGERAHALKVAYF 132 E+Q+KKR G F+WRLLEK Y M R EA AGE+A AL+ AYF Sbjct: 409 EEQIKKREGAPFMWRLLEKGYAMTGRHEAKVAGEKAKALESAYF 452 >ref|XP_003519185.1| PREDICTED: tetratricopeptide repeat protein 38-like [Glycine max] Length = 468 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = +1 Query: 1 EKQLKKRGGVQFLWRLLEKSYRMLERPEAAHAGERAHALKVAYF 132 EKQ+KKR GV +LWRLLE++Y++ +PE A E+A AL+ YF Sbjct: 424 EKQIKKRDGVPYLWRLLERAYKLANKPEERIANEKATALESRYF 467 >ref|XP_002274190.1| PREDICTED: tetratricopeptide repeat protein 38 [Vitis vinifera] gi|296086448|emb|CBI32037.3| unnamed protein product [Vitis vinifera] Length = 468 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = +1 Query: 1 EKQLKKRGGVQFLWRLLEKSYRMLERPEAAHAGERAHALKVAYF 132 EKQ+K R GV FLWRLLE+ Y M + EA AGE+A AL+ +YF Sbjct: 424 EKQVKNREGVPFLWRLLERGYSMTGKQEARVAGEKAMALETSYF 467