BLASTX nr result
ID: Cephaelis21_contig00018120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00018120 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282023.1| PREDICTED: uncharacterized protein LOC100253... 69 4e-10 emb|CAB75803.1| allyl alcohol dehydrogenase-like protein [Arabid... 66 3e-09 ref|NP_567086.1| uncharacterized protein [Arabidopsis thaliana] ... 66 3e-09 ref|XP_002333206.1| predicted protein [Populus trichocarpa] gi|1... 64 1e-08 ref|XP_002441338.1| hypothetical protein SORBIDRAFT_09g024670 [S... 64 2e-08 >ref|XP_002282023.1| PREDICTED: uncharacterized protein LOC100253981 [Vitis vinifera] gi|147843023|emb|CAN83312.1| hypothetical protein VITISV_031607 [Vitis vinifera] gi|297742156|emb|CBI33943.3| unnamed protein product [Vitis vinifera] Length = 97 Score = 68.9 bits (167), Expect = 4e-10 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = -2 Query: 248 GYCPVSDELEPCRWEILPASGSEAPQFRVVF 156 GYCPVSD+LEPCRWEILPASGS+APQFRVVF Sbjct: 67 GYCPVSDDLEPCRWEILPASGSDAPQFRVVF 97 >emb|CAB75803.1| allyl alcohol dehydrogenase-like protein [Arabidopsis thaliana] Length = 462 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 248 GYCPVSDELEPCRWEILPASGSEAPQFRVVF 156 GYCPVSD+LEPCRWEILPA G +APQFRVVF Sbjct: 432 GYCPVSDDLEPCRWEILPADGKDAPQFRVVF 462 >ref|NP_567086.1| uncharacterized protein [Arabidopsis thaliana] gi|297820828|ref|XP_002878297.1| hypothetical protein ARALYDRAFT_486449 [Arabidopsis lyrata subsp. lyrata] gi|17473784|gb|AAL38327.1| allyl alcohol dehydrogenase-like protein [Arabidopsis thaliana] gi|20148537|gb|AAM10159.1| allyl alcohol dehydrogenase-like protein [Arabidopsis thaliana] gi|21553808|gb|AAM62901.1| unknown [Arabidopsis thaliana] gi|51970082|dbj|BAD43733.1| unknown protein [Arabidopsis thaliana] gi|297324135|gb|EFH54556.1| hypothetical protein ARALYDRAFT_486449 [Arabidopsis lyrata subsp. lyrata] gi|332646454|gb|AEE79975.1| uncharacterized protein [Arabidopsis thaliana] Length = 97 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 248 GYCPVSDELEPCRWEILPASGSEAPQFRVVF 156 GYCPVSD+LEPCRWEILPA G +APQFRVVF Sbjct: 67 GYCPVSDDLEPCRWEILPADGKDAPQFRVVF 97 >ref|XP_002333206.1| predicted protein [Populus trichocarpa] gi|118483538|gb|ABK93667.1| unknown [Populus trichocarpa] gi|118485122|gb|ABK94424.1| unknown [Populus trichocarpa] gi|222835095|gb|EEE73544.1| predicted protein [Populus trichocarpa] Length = 98 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 248 GYCPVSDELEPCRWEILPASGSEAPQFRVVF 156 G+CPVSD+LEPCRWEI+PAS S+APQFRVVF Sbjct: 68 GFCPVSDDLEPCRWEIMPASDSDAPQFRVVF 98 >ref|XP_002441338.1| hypothetical protein SORBIDRAFT_09g024670 [Sorghum bicolor] gi|241946623|gb|EES19768.1| hypothetical protein SORBIDRAFT_09g024670 [Sorghum bicolor] Length = 107 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 248 GYCPVSDELEPCRWEILPASGSEAPQFRVVF 156 GYCPVSDELEPCRWE++PA+G APQFR+VF Sbjct: 77 GYCPVSDELEPCRWELVPAAGEGAPQFRIVF 107