BLASTX nr result
ID: Cephaelis21_contig00017277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00017277 (576 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267100.2| PREDICTED: zinc finger CCCH domain-containin... 69 7e-10 emb|CBI17411.3| unnamed protein product [Vitis vinifera] 69 7e-10 ref|XP_002310841.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_002333331.1| predicted protein [Populus trichocarpa] gi|2... 65 8e-09 ref|XP_003538871.1| PREDICTED: zinc finger CCCH domain-containin... 64 2e-08 >ref|XP_002267100.2| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Vitis vinifera] Length = 1643 Score = 68.6 bits (166), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 490 SRPPPKGQRVCKFYESGHCKKGASCDYLHP 401 SR PPKGQRVCKF+ESGHCKKGASCDYLHP Sbjct: 1614 SRNPPKGQRVCKFFESGHCKKGASCDYLHP 1643 >emb|CBI17411.3| unnamed protein product [Vitis vinifera] Length = 1362 Score = 68.6 bits (166), Expect = 7e-10 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 490 SRPPPKGQRVCKFYESGHCKKGASCDYLHP 401 SR PPKGQRVCKF+ESGHCKKGASCDYLHP Sbjct: 1333 SRNPPKGQRVCKFFESGHCKKGASCDYLHP 1362 >ref|XP_002310841.1| predicted protein [Populus trichocarpa] gi|222853744|gb|EEE91291.1| predicted protein [Populus trichocarpa] Length = 1256 Score = 65.1 bits (157), Expect = 8e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 487 RPPPKGQRVCKFYESGHCKKGASCDYLHP 401 RPPPKGQRVCKFYESG+CKKGASC Y HP Sbjct: 1228 RPPPKGQRVCKFYESGYCKKGASCSYWHP 1256 >ref|XP_002333331.1| predicted protein [Populus trichocarpa] gi|222836226|gb|EEE74647.1| predicted protein [Populus trichocarpa] Length = 110 Score = 65.1 bits (157), Expect = 8e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 487 RPPPKGQRVCKFYESGHCKKGASCDYLHP 401 RPPPKGQRVCKFYESG+CKKGASC Y HP Sbjct: 82 RPPPKGQRVCKFYESGYCKKGASCSYWHP 110 >ref|XP_003538871.1| PREDICTED: zinc finger CCCH domain-containing protein 44-like [Glycine max] Length = 1365 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 487 RPPPKGQRVCKFYESGHCKKGASCDYLHP 401 RP PKGQRVCKFYESG+CKKGASCDY HP Sbjct: 1337 RPLPKGQRVCKFYESGYCKKGASCDYWHP 1365