BLASTX nr result
ID: Cephaelis21_contig00016903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016903 (393 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616187.1| aarF domain-containing protein kinase, putat... 42 1e-06 ref|XP_002528516.1| Ubiquinone biosynthesis protein coq-8, putat... 38 4e-06 ref|XP_002888468.1| ABC1 family protein [Arabidopsis lyrata subs... 40 4e-06 ref|NP_176770.2| aarF domain-containing kinase [Arabidopsis thal... 39 8e-06 gb|AAF06055.1|AC009513_11 F12P19.11 [Arabidopsis thaliana] 39 8e-06 >ref|XP_003616187.1| aarF domain-containing protein kinase, putative [Medicago truncatula] gi|355517522|gb|AES99145.1| aarF domain-containing protein kinase, putative [Medicago truncatula] Length = 558 Score = 42.0 bits (97), Expect(2) = 1e-06 Identities = 17/29 (58%), Positives = 24/29 (82%) Frame = -3 Query: 232 NFIQEAKNSERAAKNFRGNSIILVSRVFF 146 +F+QEA+NSERAAKNFR N ++ + VF+ Sbjct: 231 DFVQEARNSERAAKNFRNNKMVRIPHVFW 259 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 13/22 (59%), Positives = 18/22 (81%) Frame = -1 Query: 393 LFPEYRFGWIMSKFKKSISSEL 328 L+P+YRFGW+ F K++SSEL Sbjct: 209 LYPQYRFGWLPLAFAKTVSSEL 230 >ref|XP_002528516.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] gi|223532076|gb|EEF33885.1| Ubiquinone biosynthesis protein coq-8, putative [Ricinus communis] Length = 548 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = -1 Query: 393 LFPEYRFGWIMSKFKKSISSELGA*FLDAGN 301 +FP+YRF W++S+F K+ISSEL +AGN Sbjct: 227 IFPDYRFDWLISEFTKAISSELDF-IQEAGN 256 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -3 Query: 232 NFIQEAKNSERAAKNFRGNSIILVSRVFF 146 +FIQEA NSER AKNF+ +I+ V ++F+ Sbjct: 249 DFIQEAGNSERTAKNFKNKNIVKVPQIFW 277 >ref|XP_002888468.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata] gi|297334309|gb|EFH64727.1| ABC1 family protein [Arabidopsis lyrata subsp. lyrata] Length = 550 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -3 Query: 232 NFIQEAKNSERAAKNFRGNSIILVSRVFF 146 +FIQEAKNSER AKNF+ N +I + VF+ Sbjct: 243 DFIQEAKNSERIAKNFKHNKMITIPTVFW 271 Score = 35.4 bits (80), Expect(2) = 4e-06 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 393 LFPEYRFGWIMSKFKKSISSEL 328 +FPEYRF W++ +F KSIS EL Sbjct: 221 IFPEYRFDWLVYEFVKSISQEL 242 >ref|NP_176770.2| aarF domain-containing kinase [Arabidopsis thaliana] gi|332196322|gb|AEE34443.1| aarF domain-containing kinase [Arabidopsis thaliana] Length = 551 Score = 38.9 bits (89), Expect(2) = 8e-06 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 232 NFIQEAKNSERAAKNFRGNSIILVSRVF 149 +F+QEAKNSER AKNF+ N +I + VF Sbjct: 244 DFLQEAKNSERIAKNFKHNKMITIPTVF 271 Score = 35.4 bits (80), Expect(2) = 8e-06 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 393 LFPEYRFGWIMSKFKKSISSEL 328 +FPEYRF W++ +F KSIS EL Sbjct: 222 IFPEYRFDWLVYEFVKSISQEL 243 >gb|AAF06055.1|AC009513_11 F12P19.11 [Arabidopsis thaliana] Length = 505 Score = 38.9 bits (89), Expect(2) = 8e-06 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 232 NFIQEAKNSERAAKNFRGNSIILVSRVF 149 +F+QEAKNSER AKNF+ N +I + VF Sbjct: 244 DFLQEAKNSERIAKNFKHNKMITIPTVF 271 Score = 35.4 bits (80), Expect(2) = 8e-06 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -1 Query: 393 LFPEYRFGWIMSKFKKSISSEL 328 +FPEYRF W++ +F KSIS EL Sbjct: 222 IFPEYRFDWLVYEFVKSISQEL 243