BLASTX nr result
ID: Cephaelis21_contig00016790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016790 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY84675.1| multicopy suppressor of IRA1 [Nicotiana tabacum] 66 3e-22 gb|ADV77222.1| multicopy suppressor of IRA1 [Malus x domestica] 66 2e-21 ref|NP_001234002.1| WD-40 repeat-containing protein MSI1 [Solanu... 64 3e-21 ref|XP_004133950.1| PREDICTED: WD-40 repeat-containing protein M... 66 1e-20 ref|XP_002320581.1| nucleosome/chromatin assembly factor group [... 66 2e-20 >gb|ABY84675.1| multicopy suppressor of IRA1 [Nicotiana tabacum] Length = 424 Score = 66.2 bits (160), Expect(2) = 3e-22 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 232 EWPSLTVEWFSDQEEPPGKDYSIQKIILGTHISADQ 125 EWPSLTVEW D+EEPPGKDYS+QK+ILGTH S ++ Sbjct: 41 EWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENE 76 Score = 63.5 bits (153), Expect(2) = 3e-22 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 129 TKNEPNYLMPAQVQLFLEDAENDAHYYDENRSEYGVFCCTN 7 ++NEPNYLM AQVQL LEDAENDA +YD++RSE+G F C N Sbjct: 73 SENEPNYLMLAQVQLPLEDAENDARHYDDDRSEFGGFGCAN 113 >gb|ADV77222.1| multicopy suppressor of IRA1 [Malus x domestica] Length = 422 Score = 66.2 bits (160), Expect(2) = 2e-21 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 232 EWPSLTVEWFSDQEEPPGKDYSIQKIILGTHISADQ 125 EWPSLTVEW D+EEPPGKDYS+QK+ILGTH S ++ Sbjct: 41 EWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENE 76 Score = 60.8 bits (146), Expect(2) = 2e-21 Identities = 28/41 (68%), Positives = 34/41 (82%) Frame = -1 Query: 129 TKNEPNYLMPAQVQLFLEDAENDAHYYDENRSEYGVFCCTN 7 ++NEPNYLM AQVQL LEDAENDA +YD++R+E G F C N Sbjct: 73 SENEPNYLMLAQVQLPLEDAENDARHYDDDRAEVGGFGCAN 113 >ref|NP_001234002.1| WD-40 repeat-containing protein MSI1 [Solanum lycopersicum] gi|3122386|sp|O22466.1|MSI1_SOLLC RecName: Full=WD-40 repeat-containing protein MSI1 gi|2394227|gb|AAB70241.1| WD-40 repeat protein [Solanum lycopersicum] Length = 424 Score = 63.5 bits (153), Expect(2) = 3e-21 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 129 TKNEPNYLMPAQVQLFLEDAENDAHYYDENRSEYGVFCCTN 7 ++NEPNYLM AQVQL LEDAENDA +YD++RSE+G F C N Sbjct: 73 SENEPNYLMLAQVQLPLEDAENDARHYDDDRSEFGGFGCAN 113 Score = 63.2 bits (152), Expect(2) = 3e-21 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -3 Query: 232 EWPSLTVEWFSDQEEPPGKDYSIQKIILGTHISADQ 125 EWPSLTVEW D+EEP GKDYS+QK+ILGTH S ++ Sbjct: 41 EWPSLTVEWLPDREEPSGKDYSVQKMILGTHTSENE 76 >ref|XP_004133950.1| PREDICTED: WD-40 repeat-containing protein MSI1-like [Cucumis sativus] gi|449515418|ref|XP_004164746.1| PREDICTED: WD-40 repeat-containing protein MSI1-like [Cucumis sativus] Length = 423 Score = 66.2 bits (160), Expect(2) = 1e-20 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 232 EWPSLTVEWFSDQEEPPGKDYSIQKIILGTHISADQ 125 EWPSLTVEW D+EEPPGKDYS+QK+ILGTH S ++ Sbjct: 41 EWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENE 76 Score = 58.2 bits (139), Expect(2) = 1e-20 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 129 TKNEPNYLMPAQVQLFLEDAENDAHYYDENRSEYGVFCCTN 7 ++NEPNYLM AQVQL LED+ENDA +YD++R++ G F C N Sbjct: 73 SENEPNYLMLAQVQLPLEDSENDARHYDDDRADAGGFGCAN 113 >ref|XP_002320581.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] gi|222861354|gb|EEE98896.1| nucleosome/chromatin assembly factor group [Populus trichocarpa] Length = 424 Score = 66.2 bits (160), Expect(2) = 2e-20 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 232 EWPSLTVEWFSDQEEPPGKDYSIQKIILGTHISADQ 125 EWPSLTVEW D+EEPPGKDYS+QK+ILGTH S ++ Sbjct: 41 EWPSLTVEWLPDREEPPGKDYSVQKMILGTHTSENE 76 Score = 57.8 bits (138), Expect(2) = 2e-20 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = -1 Query: 129 TKNEPNYLMPAQVQLFLEDAENDAHYYDENRSEYGVFCCTN 7 ++NEPNYLM AQVQL L+DAENDA +YD++RS++G F N Sbjct: 73 SENEPNYLMLAQVQLPLDDAENDARHYDDDRSDFGGFGAAN 113