BLASTX nr result
ID: Cephaelis21_contig00016468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016468 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis] g... 56 3e-06 >ref|XP_002519934.1| reticulon3-A3, putative [Ricinus communis] gi|223540980|gb|EEF42538.1| reticulon3-A3, putative [Ricinus communis] Length = 639 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 334 QYKTVFSSFKDIKVIQFSTMQDAFKGFTDK 423 ++KTVFSSFKD+KVIQFS+MQDAF GFTDK Sbjct: 555 KFKTVFSSFKDVKVIQFSSMQDAFLGFTDK 584