BLASTX nr result
ID: Cephaelis21_contig00016459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016459 (236 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitoch... 77 1e-12 ref|XP_002298203.1| amidase family protein [Populus trichocarpa]... 75 7e-12 ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitoch... 74 1e-11 ref|XP_003524732.1| PREDICTED: glutamyl-tRNA(Gln) amidotransfera... 72 5e-11 ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|2235... 70 1e-10 >ref|XP_002268888.1| PREDICTED: outer envelope protein 64, mitochondrial [Vitis vinifera] gi|296086830|emb|CBI32979.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -3 Query: 234 NVKVYL*RGTAKESLLFYKKALQDFKHAVVL*PQNKVSNLAEKRLRKL 91 NVK YL RGTA+ESLL YK+A QDFKHA+VL PQNKV+NLAEKRLRKL Sbjct: 558 NVKAYLRRGTARESLLCYKEAAQDFKHALVLEPQNKVANLAEKRLRKL 605 >ref|XP_002298203.1| amidase family protein [Populus trichocarpa] gi|222845461|gb|EEE83008.1| amidase family protein [Populus trichocarpa] Length = 599 Score = 74.7 bits (182), Expect = 7e-12 Identities = 38/48 (79%), Positives = 41/48 (85%) Frame = -3 Query: 234 NVKVYL*RGTAKESLLFYKKALQDFKHAVVL*PQNKVSNLAEKRLRKL 91 NVK YL RGTA+ESLLFYK A QDFKHA+VL PQNKV+ AEKRLRKL Sbjct: 550 NVKAYLRRGTARESLLFYKDAAQDFKHALVLEPQNKVARHAEKRLRKL 597 >ref|XP_004136877.1| PREDICTED: outer envelope protein 64, mitochondrial-like [Cucumis sativus] Length = 606 Score = 73.9 bits (180), Expect = 1e-11 Identities = 36/47 (76%), Positives = 43/47 (91%) Frame = -3 Query: 231 VKVYL*RGTAKESLLFYKKALQDFKHAVVL*PQNKVSNLAEKRLRKL 91 VK YL RGTA+ESLL YK+A++DFKHA+VL PQNKV+NLAEKRL+KL Sbjct: 558 VKAYLRRGTARESLLLYKEAIKDFKHALVLEPQNKVANLAEKRLQKL 604 >ref|XP_003524732.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like [Glycine max] Length = 603 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -3 Query: 234 NVKVYL*RGTAKESLLFYKKALQDFKHAVVL*PQNKVSNLAEKRLRKL 91 NVK YL RGTA+ESLL Y++AL+DFKHA+VL PQNK ++LAEKRLRKL Sbjct: 554 NVKAYLRRGTARESLLCYEEALEDFKHALVLEPQNKDASLAEKRLRKL 601 >ref|XP_002525865.1| amidase, putative [Ricinus communis] gi|223534870|gb|EEF36559.1| amidase, putative [Ricinus communis] Length = 607 Score = 70.5 bits (171), Expect = 1e-10 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = -3 Query: 234 NVKVYL*RGTAKESLLFYKKALQDFKHAVVL*PQNKVSNLAEKRLRKL 91 NVK YL RGTAKESLL+YK+A QDFKHA+VL P NK + AE+RLRKL Sbjct: 558 NVKAYLRRGTAKESLLYYKEAAQDFKHALVLEPHNKAAREAEERLRKL 605