BLASTX nr result
ID: Cephaelis21_contig00016430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016430 (488 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513883.1| conserved hypothetical protein [Ricinus comm... 48 3e-06 gb|AEK94314.1| hypothetical protein [Pyrus x bretschneideri] 42 7e-06 >ref|XP_002513883.1| conserved hypothetical protein [Ricinus communis] gi|223546969|gb|EEF48466.1| conserved hypothetical protein [Ricinus communis] Length = 172 Score = 48.1 bits (113), Expect(2) = 3e-06 Identities = 25/45 (55%), Positives = 29/45 (64%), Gaps = 8/45 (17%) Frame = -2 Query: 370 MLLGKRPRPPIKRTTSVTGFSLDLSNNKSIE--------GGDGDG 260 MLLGKRPRPP+KRTTS++ + DL N S E GGDG G Sbjct: 1 MLLGKRPRPPMKRTTSLSEITFDLDTNGSCESAQQAAGFGGDGTG 45 Score = 27.7 bits (60), Expect(2) = 3e-06 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -3 Query: 141 LDQRFMXXXAVSPSPRPRTLRRNSXXXXXXXXXXXFLRACALCKRRL 1 LDQRF+ +SP R RR S LR+C+LC RRL Sbjct: 53 LDQRFLAAATISP----RNHRRASADFLETAHF---LRSCSLCHRRL 92 >gb|AEK94314.1| hypothetical protein [Pyrus x bretschneideri] Length = 161 Score = 41.6 bits (96), Expect(2) = 7e-06 Identities = 24/51 (47%), Positives = 31/51 (60%) Frame = -2 Query: 370 MLLGKRPRPPIKRTTSVTGFSLDLSNNKSIEGGDGDGGVNPQIFDPNNPFK 218 M LGKRPRPP+KRTTS++ + D N S E + Q DPNNP++ Sbjct: 1 MSLGKRPRPPMKRTTSMSEITFD-PNTISTE------APHSQPSDPNNPYQ 44 Score = 33.1 bits (74), Expect(2) = 7e-06 Identities = 20/47 (42%), Positives = 22/47 (46%) Frame = -3 Query: 141 LDQRFMXXXAVSPSPRPRTLRRNSXXXXXXXXXXXFLRACALCKRRL 1 LDQR M S PR +RNS L+AC LCKRRL Sbjct: 66 LDQRLMMKLPSPSSASPRNQKRNSADFGETAHF---LKACGLCKRRL 109