BLASTX nr result
ID: Cephaelis21_contig00016368
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016368 (854 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana taba... 92 1e-16 gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana taba... 92 1e-16 gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana taba... 92 1e-16 gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana taba... 92 1e-16 gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana taba... 92 1e-16 >gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 252 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/97 (44%), Positives = 67/97 (69%) Frame = -2 Query: 295 NIAPITDDFVGFQDEERSMIDQLTRGSKKLKMAAIVGMPGLGKTTLATKVYNDPSLTFHF 116 ++ I ++ VGF+ + S++ +L G+K+L + +I GMPGLGKTTLA KVYN+PS+ HF Sbjct: 26 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 85 Query: 115 QLRVWCCVSQQFDKKKVLLQLLNHIVPKGNFEMAEQD 5 RVWC VSQ + ++ +L+++L GN+E+ E D Sbjct: 86 DARVWCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDD 121 >gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 249 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/97 (44%), Positives = 67/97 (69%) Frame = -2 Query: 295 NIAPITDDFVGFQDEERSMIDQLTRGSKKLKMAAIVGMPGLGKTTLATKVYNDPSLTFHF 116 ++ I ++ VGF+ + S++ +L G+K+L + +I GMPGLGKTTLA KVYN+PS+ HF Sbjct: 26 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 85 Query: 115 QLRVWCCVSQQFDKKKVLLQLLNHIVPKGNFEMAEQD 5 RVWC VSQ + ++ +L+++L GN+E+ E D Sbjct: 86 DARVWCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDD 121 >gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 245 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/97 (44%), Positives = 67/97 (69%) Frame = -2 Query: 295 NIAPITDDFVGFQDEERSMIDQLTRGSKKLKMAAIVGMPGLGKTTLATKVYNDPSLTFHF 116 ++ I ++ VGF+ + S++ +L G+K+L + +I GMPGLGKTTLA KVYN+PS+ HF Sbjct: 19 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 78 Query: 115 QLRVWCCVSQQFDKKKVLLQLLNHIVPKGNFEMAEQD 5 RVWC VSQ + ++ +L+++L GN+E+ E D Sbjct: 79 DARVWCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDD 114 >gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 250 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/97 (44%), Positives = 67/97 (69%) Frame = -2 Query: 295 NIAPITDDFVGFQDEERSMIDQLTRGSKKLKMAAIVGMPGLGKTTLATKVYNDPSLTFHF 116 ++ I ++ VGF+ + S++ +L G+K+L + +I GMPGLGKTTLA KVYN+PS+ HF Sbjct: 26 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 85 Query: 115 QLRVWCCVSQQFDKKKVLLQLLNHIVPKGNFEMAEQD 5 RVWC VSQ + ++ +L+++L GN+E+ E D Sbjct: 86 DARVWCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDD 121 >gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana tabacum] Length = 252 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/97 (44%), Positives = 67/97 (69%) Frame = -2 Query: 295 NIAPITDDFVGFQDEERSMIDQLTRGSKKLKMAAIVGMPGLGKTTLATKVYNDPSLTFHF 116 ++ I ++ VGF+ + S++ +L G+K+L + +I GMPGLGKTTLA KVYN+PS+ HF Sbjct: 27 SLPSIDEEVVGFEKDAESIMKKLIGGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHF 86 Query: 115 QLRVWCCVSQQFDKKKVLLQLLNHIVPKGNFEMAEQD 5 RVWC VSQ + ++ +L+++L GN+E+ E D Sbjct: 87 DARVWCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDD 122