BLASTX nr result
ID: Cephaelis21_contig00016348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016348 (1292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523538.1| conserved hypothetical protein [Ricinus comm... 58 5e-06 >ref|XP_002523538.1| conserved hypothetical protein [Ricinus communis] gi|223537245|gb|EEF38877.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 58.2 bits (139), Expect = 5e-06 Identities = 42/116 (36%), Positives = 51/116 (43%), Gaps = 2/116 (1%) Frame = +2 Query: 245 PDRSRDVNQDRKSPSPVSDGVSPKSNLVMGQVKILKRGEALPDLSNNNKPHXXXXXXXXX 424 P R+ +S S P N VMG+VKILKRGE+L + Sbjct: 33 PPRNPQAFNHHRSRSGAMVAKFPSRNFVMGEVKILKRGESLAKVDKRGLSKKEKRKHPTM 92 Query: 425 XXXXXXXXXXWKKLGSGGRQNEDELILCSTGRLGPDPETVQMQIRAS--DFYAGSG 586 + + +LIL ST RLGPDPETVQ QIR S + YAGSG Sbjct: 93 IMKI---------------EKDPDLILGSTDRLGPDPETVQEQIRLSINEIYAGSG 133