BLASTX nr result
ID: Cephaelis21_contig00016347
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016347 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20729.3| unnamed protein product [Vitis vinifera] 79 3e-13 ref|XP_002281615.1| PREDICTED: myosin-H heavy chain-like [Vitis ... 79 3e-13 emb|CAN64315.1| hypothetical protein VITISV_036695 [Vitis vinifera] 79 3e-13 ref|XP_002516146.1| myosin XI, putative [Ricinus communis] gi|22... 78 6e-13 dbj|BAK61882.1| myosin XI [Citrus unshiu] 78 9e-13 >emb|CBI20729.3| unnamed protein product [Vitis vinifera] Length = 1524 Score = 78.6 bits (192), Expect(2) = 3e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 220 EVC*DASGRISGAAIRTYLLERSRVVQITDLERNYHYFYQLCASG 86 E+ DA+GRISGAAIRTYLLERSRVVQITD ERNYH FYQLCASG Sbjct: 217 EIQFDANGRISGAAIRTYLLERSRVVQITDPERNYHCFYQLCASG 261 Score = 20.8 bits (42), Expect(2) = 3e-13 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 231 SRFGKFVEM 205 SRFGKFVE+ Sbjct: 210 SRFGKFVEI 218 >ref|XP_002281615.1| PREDICTED: myosin-H heavy chain-like [Vitis vinifera] Length = 1517 Score = 78.6 bits (192), Expect(2) = 3e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 220 EVC*DASGRISGAAIRTYLLERSRVVQITDLERNYHYFYQLCASG 86 E+ DA+GRISGAAIRTYLLERSRVVQITD ERNYH FYQLCASG Sbjct: 217 EIQFDANGRISGAAIRTYLLERSRVVQITDPERNYHCFYQLCASG 261 Score = 20.8 bits (42), Expect(2) = 3e-13 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 231 SRFGKFVEM 205 SRFGKFVE+ Sbjct: 210 SRFGKFVEI 218 >emb|CAN64315.1| hypothetical protein VITISV_036695 [Vitis vinifera] Length = 974 Score = 78.6 bits (192), Expect(2) = 3e-13 Identities = 39/45 (86%), Positives = 41/45 (91%) Frame = -3 Query: 220 EVC*DASGRISGAAIRTYLLERSRVVQITDLERNYHYFYQLCASG 86 E+ DA+GRISGAAIRTYLLERSRVVQITD ERNYH FYQLCASG Sbjct: 217 EIQFDANGRISGAAIRTYLLERSRVVQITDPERNYHCFYQLCASG 261 Score = 20.8 bits (42), Expect(2) = 3e-13 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 231 SRFGKFVEM 205 SRFGKFVE+ Sbjct: 210 SRFGKFVEI 218 >ref|XP_002516146.1| myosin XI, putative [Ricinus communis] gi|223544632|gb|EEF46148.1| myosin XI, putative [Ricinus communis] Length = 1518 Score = 77.8 bits (190), Expect(2) = 6e-13 Identities = 39/45 (86%), Positives = 40/45 (88%) Frame = -3 Query: 220 EVC*DASGRISGAAIRTYLLERSRVVQITDLERNYHYFYQLCASG 86 E+ DA GRISGAAIRTYLLERSRVVQITD ERNYH FYQLCASG Sbjct: 219 EIQFDAHGRISGAAIRTYLLERSRVVQITDPERNYHCFYQLCASG 263 Score = 20.8 bits (42), Expect(2) = 6e-13 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = -1 Query: 231 SRFGKFVEM 205 SRFGKFVE+ Sbjct: 212 SRFGKFVEI 220 >dbj|BAK61882.1| myosin XI [Citrus unshiu] Length = 720 Score = 77.8 bits (190), Expect = 9e-13 Identities = 40/57 (70%), Positives = 44/57 (77%) Frame = -3 Query: 256 LVWFWYSLQSLWEVC*DASGRISGAAIRTYLLERSRVVQITDLERNYHYFYQLCASG 86 LV + + E+ D +GRISGAAIRTYLLERSRVVQITD ERNYH FYQLCASG Sbjct: 220 LVGYKHRFGKFVEIQFDTNGRISGAAIRTYLLERSRVVQITDPERNYHCFYQLCASG 276