BLASTX nr result
ID: Cephaelis21_contig00016281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016281 (922 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER53178.1| translation initiation factor 1 [Asclepias subaph... 101 2e-19 gb|AER52693.1| translation initiation factor 1 [Asclepias cutler... 101 2e-19 ref|XP_003628540.1| Translation initiation factor [Medicago trun... 101 2e-19 ref|NP_001237201.1| translation initiation factor IF-1, chloropl... 101 2e-19 gb|AER52856.1| translation initiation factor 1 [Asclepias leptopus] 101 3e-19 >gb|AER53178.1| translation initiation factor 1 [Asclepias subaphylla] Length = 91 Score = 101 bits (252), Expect = 2e-19 Identities = 50/101 (49%), Positives = 70/101 (69%) Frame = +1 Query: 496 DAEKKWTHHGLVTESLPNGMFRVGLVNLVDSKFVRINDDVMLGYVSGKIRTNHIRVVPGD 675 + E+KW H GL+TESLPNGMFRV L N +D++LGY+SGKIR + IR++PGD Sbjct: 3 EKEQKWIHEGLITESLPNGMFRVRLDN----------EDLILGYISGKIRRSFIRILPGD 52 Query: 676 IVRIEITPYDSNKGRIVYRLSRRDMEKLTGSSSRDDFEEND 798 V++E++ YDS KGRI+YRL ++D + S+D+ E D Sbjct: 53 RVKVEVSRYDSTKGRIIYRLRKKDSK--DKKDSKDNKESKD 91 >gb|AER52693.1| translation initiation factor 1 [Asclepias cutleri] gi|355332090|gb|AER52775.1| translation initiation factor 1 [Asclepias cutleri] gi|355332255|gb|AER52938.1| translation initiation factor 1 [Asclepias macrotis] gi|355332336|gb|AER53018.1| translation initiation factor 1 [Asclepias macrotis] gi|355332743|gb|AER53420.1| translation initiation factor 1 [Asclepias subulata] Length = 91 Score = 101 bits (252), Expect = 2e-19 Identities = 48/99 (48%), Positives = 68/99 (68%) Frame = +1 Query: 496 DAEKKWTHHGLVTESLPNGMFRVGLVNLVDSKFVRINDDVMLGYVSGKIRTNHIRVVPGD 675 + E+KW H GL+TESLPNGMFRV L N +D++LGY+SGKIR + IR++PGD Sbjct: 3 EKEQKWIHEGLITESLPNGMFRVRLDN----------EDLILGYISGKIRRSFIRILPGD 52 Query: 676 IVRIEITPYDSNKGRIVYRLSRRDMEKLTGSSSRDDFEE 792 V++E++ YDS KGRI+YRL ++D + S D ++ Sbjct: 53 RVKVEVSRYDSTKGRIIYRLRKKDSKDKKDSKDNKDSKD 91 >ref|XP_003628540.1| Translation initiation factor [Medicago truncatula] gi|355522562|gb|AET03016.1| Translation initiation factor [Medicago truncatula] Length = 147 Score = 101 bits (252), Expect = 2e-19 Identities = 47/85 (55%), Positives = 64/85 (75%) Frame = +1 Query: 481 TAPSLDAEKKWTHHGLVTESLPNGMFRVGLVNLVDSKFVRINDDVMLGYVSGKIRTNHIR 660 + P +E+KW H GL+TESLPNGMFRV L N +D++LGY+SG+IR N++R Sbjct: 64 STPDKASEQKWVHEGLITESLPNGMFRVRLDN----------EDLILGYISGRIRKNYVR 113 Query: 661 VVPGDIVRIEITPYDSNKGRIVYRL 735 ++PGD VR+E++ YDS+KGRIVYRL Sbjct: 114 ILPGDRVRVEVSRYDSSKGRIVYRL 138 >ref|NP_001237201.1| translation initiation factor IF-1, chloroplastic [Glycine max] gi|75166516|sp|Q94KR7.1|IF1C_SOYBN RecName: Full=Translation initiation factor IF-1, chloroplastic; Flags: Precursor gi|13774427|gb|AAK38870.1|AF347666_1 translation initiation factor IF1 [Glycine max] Length = 138 Score = 101 bits (252), Expect = 2e-19 Identities = 48/91 (52%), Positives = 63/91 (69%) Frame = +1 Query: 463 LGKTTKTAPSLDAEKKWTHHGLVTESLPNGMFRVGLVNLVDSKFVRINDDVMLGYVSGKI 642 L + P E+KW H GL+ ESLPNGMFRV L N +D++LGY+SGKI Sbjct: 52 LSAASAAKPDKSGEQKWVHEGLIMESLPNGMFRVRLDN----------EDLILGYISGKI 101 Query: 643 RTNHIRVVPGDIVRIEITPYDSNKGRIVYRL 735 R N++R++PGD V++E+T YDS+KGRIVYRL Sbjct: 102 RKNYVRILPGDRVKVEVTRYDSSKGRIVYRL 132 >gb|AER52856.1| translation initiation factor 1 [Asclepias leptopus] Length = 91 Score = 101 bits (251), Expect = 3e-19 Identities = 48/99 (48%), Positives = 68/99 (68%) Frame = +1 Query: 496 DAEKKWTHHGLVTESLPNGMFRVGLVNLVDSKFVRINDDVMLGYVSGKIRTNHIRVVPGD 675 + E+KW H GL+TESLPNGMFRV L N +D++LGY+SGKIR + IR++PGD Sbjct: 3 EKEQKWIHEGLITESLPNGMFRVRLDN----------EDLILGYISGKIRRSFIRILPGD 52 Query: 676 IVRIEITPYDSNKGRIVYRLSRRDMEKLTGSSSRDDFEE 792 V++E++ YDS KGRI+YRL ++D + S D ++ Sbjct: 53 RVKVEVSRYDSTKGRIIYRLRKKDSKDNKDSKDNKDSKD 91