BLASTX nr result
ID: Cephaelis21_contig00016248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00016248 (2392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003591466.1| Mitochondrial folate transporter/carrier [Me... 65 6e-08 ref|ZP_11076087.1| hypothetical protein B857_03969 [Bacillus isr... 62 7e-07 ref|ZP_11072118.1| hypothetical protein B879_04163 [Cecembia lon... 62 9e-07 emb|CCH50976.1| T4.15 [Malus x robusta] 60 2e-06 ref|XP_003601268.1| Serine-protein kinase ATM [Medicago truncatu... 60 4e-06 >ref|XP_003591466.1| Mitochondrial folate transporter/carrier [Medicago truncatula] gi|355480514|gb|AES61717.1| Mitochondrial folate transporter/carrier [Medicago truncatula] Length = 379 Score = 65.5 bits (158), Expect = 6e-08 Identities = 31/58 (53%), Positives = 43/58 (74%) Frame = -2 Query: 306 KIEESLNQIKRGRERPKKTWKETIKNDMNYLNLNENMCFDRARWRALIHIADPHSGIK 133 ++EES ++KRGR RP+KT +ETI+ D+ L+ NM +DR WR LIH+ADP SGI+ Sbjct: 156 QMEES--RVKRGRGRPRKTIRETIRKDLEVNELDPNMVYDRTLWRNLIHVADPLSGIR 211 >ref|ZP_11076087.1| hypothetical protein B857_03969 [Bacillus isronensis B3W22] gi|405383715|gb|EKB43273.1| hypothetical protein B857_03969 [Bacillus isronensis B3W22] Length = 109 Score = 62.0 bits (149), Expect = 7e-07 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = -2 Query: 285 QIKRGRERPKKTWKETIKNDMNYLNLNENMCFDRARWRALIHIADP 148 Q +RGR RP+KT +ET++ D+ YL+L E+M DRA+WR+ IHIADP Sbjct: 62 QGRRGRGRPRKTLEETLRKDLEYLDLTEDMTQDRAQWRSKIHIADP 107 >ref|ZP_11072118.1| hypothetical protein B879_04163 [Cecembia lonarensis LW9] gi|405551390|gb|EKB47241.1| hypothetical protein B879_04163 [Cecembia lonarensis LW9] Length = 133 Score = 61.6 bits (148), Expect = 9e-07 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = -2 Query: 279 KRGRERPKKTWKETIKNDMNYLNLNENMCFDRARWRALIHIADP 148 +RGR RP+KT +ET++ D+ YL+L E+M DRA+WR+ IHIADP Sbjct: 88 RRGRGRPRKTLEETLRKDLEYLDLTEDMTQDRAQWRSRIHIADP 131 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 60.5 bits (145), Expect = 2e-06 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = -2 Query: 285 QIKRGRERPKKTWKETIKNDMNYLNLNENMCFDRARWRALIHIADP 148 Q +RGR RP+KT +ET++ D+ YL+L ++M DRA+WR+ IHIADP Sbjct: 939 QGRRGRGRPRKTLEETLRKDLEYLDLTKDMTQDRAQWRSKIHIADP 984 >ref|XP_003601268.1| Serine-protein kinase ATM [Medicago truncatula] gi|355490316|gb|AES71519.1| Serine-protein kinase ATM [Medicago truncatula] Length = 1676 Score = 59.7 bits (143), Expect = 4e-06 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = -2 Query: 306 KIEESLNQIKRGRERPKKTWKETIKNDMNYLNLNENMCFDRARWRALIHIADPH 145 ++EES Q+KRGR RPKKT +ETI+ D+ L+ NM FDR WR LIH+ H Sbjct: 194 QMEES--QVKRGRGRPKKTIRETIRKDLEVNELDPNMVFDRTLWRYLIHVLKEH 245